Recombinant Human BTN1A1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10595P
Recombinant Human BTN1A1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10595P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q13410 |
Synonym | BT BT1A1_HUMAN BTN BTN1 Btn1a1 butyrophilin Butyrophilin subfamily 1 member A1 butyrophilin, subfamily 1, member A1 |
Description | Recombinant Human BTN1A1 Protein (His tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | APFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLELRWFRKKVSPAVLV HRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDGEYTCFF REDGSYEEALVHLKVAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQ WRTSKGEKFPSTSESRNPDEEGLFTVAASVIIRDTSAKNVSCYIQNLLLG QEKKVEISIPASSLPR |
Molecular Weight | 26 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle. |