Recombinant Human B7-H6 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10591P
Recombinant Human B7-H6 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10591P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q68D85 |
Synonym | B7 homolog 6 B7-H6 B7H6 B7H6_HUMAN DKFZp686O24166 Natural cytotoxicity triggering receptor 3 ligand 1 NCR3LG1 Putative Ig like domain containing protein DKFZp686O24166/DKFZp686I21167 |
Description | Recombinant Human B7-H6 Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDK EVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEV VVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAIN ITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGT VYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS |
Molecular Weight | 80 kDa including tags |
Purity | >98% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated human T cells. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C. Avoid freeze / thaw cycle. |