Recombinant Human B7-H4 Protein
Beta LifeScience
SKU/CAT #: BLA-10587P
Recombinant Human B7-H4 Protein
Beta LifeScience
SKU/CAT #: BLA-10587P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q7Z7D3 |
Synonym | B7 family member, H4 B7 H4 B7 homolog 4 B7 superfamily member 1 B7 superfamily, member 1 B7-H4 B7h.5 B7h4 B7S1 B7x BC032925 Immune costimulatory protein B7-H4 Immune costimulatory protein B7H4 MGC41287 PRO1291 Protein B7S1 RP11 229A19.4 T cell costimulatory molecule B7x T-cell costimulatory molecule B7x V set domain-containing T cell activation inhibitor 1 V-set domain-containing T-cell activation inhibitor 1 VCTN1 Vtcn1 VTCN1_HUMAN |
Description | Recombinant Human B7-H4 Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLG LVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTY KCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPT VVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIE NDIAKATGDIKVTESEIKRRSHLQLLNSKA |
Molecular Weight | 26 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Measured by its ability to inhibit anti-CD3 antibody induced IL2 secretion in Human T lymphocytes.The ED50 for this effect is typically 0.75 - 3 µg/ml. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Protein Families | Immunoglobulin superfamily, BTN/MOG family |
Database References | |
Tissue Specificity | Overexpressed in breast, ovarian, endometrial, renal cell (RCC) and non-small-cell lung cancers (NSCLC). Expressed on activated T- and B-cells, monocytes and dendritic cells, but not expressed in most normal tissues (at protein level). Widely expressed, i |
Gene Functions References
- None of the genotype distributions showed a significant difference from the control group for the rs10801935 polymorphism. We conclude that B7-H4 has the potential to be a useful prognostic marker in urothelial carcinoma. PMID: 28425229
- B7-H4/NF-kappaB signaling is involved in the EMT and invasion of bladder cancer cells. PMID: 29391086
- The aim of the present work was to evaluate the effectiveness of anti-B7-H4-scFv-CH3 against tumors in vitro and in vivo. ScFv can inhibit signaling pathways to improve immunity by binding with the T lymphocyte negative co-stimulatory factor B7-H4. PMID: 30207312
- High B7-H4 expression is associated with phyllodes tumors. PMID: 30486739
- Studies suggest that V-set domain containing T cell activation inhibitor 1 protein (B7S1) may represent a very promising candidate to be targeted to treat various tumors. PMID: 30069671
- Human Immunodeficiency virus type-1 myeloid derived suppressor cells inhibit cytomegalovirus inflammation through IL-27 and B7-H4. PMID: 28338007
- High B7-H4 expression is associated with glioblastoma. PMID: 30159779
- Serum B7-H4 detection, either alone or in combination with carbohydrate antigen 125, has an acceptable value in the diagnosis of OC. PMID: 29970702
- the findings of this study suggested that B7-H4 may have the potential to be a valuable prognostic marker and a target for individualized therapies for gastric cancer PMID: 29436630
- Upregulation of B7-H4 promotes tumor progression of intrahepatic cholangiocarcinoma. PMID: 29235470
- B7-H3 protein is expressed in the majority of NSCLCs and is associated with smoking history. High levels of B7-H3 protein have a negative prognostic impact in lung carcinomas. Coexpression of B7-H3 with PD-L1 and B7-H4 is relatively low, suggesting a nonredundant biological role of these targets. PMID: 28539467
- When compared to early-stage lung adenocarcinoma, metastatic pleural adenocarcinoma possessed higher level of nuclei membranous B7-H4 and lower cytoplasmic B7-H4 expression. PMID: 28923053
- The decrease of B7-H4 expression in salivary glands of Sjogren's syndrome patients contributes to the defect of negatively regulating the inflammation caused by CD4(+) T cells. PMID: 28217953
- Preclinical investigation into B7-H4-specific chimeric antigen receptor (CAR) T cells, antibody-mediated blockade of B7-H4, and anti-B7-H4 drug conjugates has shown antitumor efficacy in mouse models. PMID: 28325750
- This meta-analysis demonstrated that high B7-H4 expression is an unfavorable prognostic factor in NSCLC. PMID: 28404927
- This meta-analysis clarified that high B7-H4 expression in tissue was significantly associated with poor survival in patients with solid tumors. PMID: 27058425
- in pulmonary adenocarcinoma presenting with SPN, nuclear membrane localization of B7-H4 within the tumor cells is associated with increased malignancy PMID: 27438152
- Study reportes that B7-H3 and B7-H4 are highly expressed in human esophageal cancer tissues and significantly associated with tumor invasion. PMID: 27764786
- Results revealed B7-H4 to be associated with poor prognosis in patients with pancreatic cancer liver metastasis. B7-H4 may promote pancreatic cancer metastasis. PMID: 27750217
- PD-L1, IDO-1, and B7-H4 are differentially expressed in human lung carcinomas and show limited co-expression. While PD-L1 and IDO-1 are associated with increased tumor-infiltrating lymphoycte and IFN-gamma stimulation, B7-H4 is not. PMID: 27440266
- B7-H4 activation on Mphis/microglia in the microenvironment of gliomas is an important immunosuppressive event blocking effective T-cell immune responses. PMID: 27001312
- Knockdown of B7-H4 significantly up-regulated 57 miRNAs and down-regulated 14 miRNAs. PMID: 29145206
- Increased serum levels of sB7-H4 in early pregnancy in premature rupture of the amniotic membranes cases may indicate the dynamics of the immune response at the feto-maternal interface and, thus, may serve as a predictive marker for this pregnancy complication. PMID: 27302185
- our study demonstrates a strong promoting role of B7-H4 in lung tumor growth, progression and metastasis PMID: 28061481
- results demonstrated for the first time that miR-125b-5p could regulate the inflammatory state of macrophages via directly targeting B7-H4 PMID: 28754594
- B7-H4 is highly expressed in pancreatic cancer, and is an independent predictor of poor prognosis. PMID: 28600225
- Evidence of associations between genotypes and Juvenile Idiopathic Arthritis were found for VTCN1, while VTCN1_rs2358820 GA was associated with Uveitis . PMID: 28145159
- B7-H4 is highly expressed in human OSCC tissue, and the B7-H4 expression level was associated with the clinicopathological parameters containing pathological grade and lymph node status. PMID: 27383830
- High B7-H4 expression is associated with non-Hodgkin lymphoma. PMID: 28246881
- B7-H4 is frequently expressed in ovarian serous carcinomas, especially high-grade serous carcinomas, and may represent a novel immunotherapeutic target in this cancer. PMID: 27349304
- While PD-L1 expression correlated with MSI and high grade endometrial tumors, B7-H4 expression was independent of grade, histology and immune cell infiltration. PMID: 28347512
- the present review highlights the therapeutic potential of targeting B7-H4 in cancer PMID: 28258701
- Survival rate of the patients with higher B7-H4 expression was significantly worse than that of the patients with lower B7-H4 expression. PMID: 28412458
- Study provides evidence that B7-H4 expression is present in cervical intraepithelial neoplasia and cervical cancer patients and suggests its involvement in cervical cancer progression. PMID: 28260085
- this review shows that targeting the B7-H4 molecule may provide a promising potential for anticancer immunotherapy PMID: 27258187
- Higher expression of HBx and B7-H4 was correlated with tumor progression of hepatitis B virus-hepatocellular carcinoma, suggesting that B7-H4 may be involved in facilitating HBV-related hepatocarcinogenesis. PMID: 27182163
- Aberrant expression of B7-H4 has been identified to correlate with the TNM stage, differentiation degree and lymph node metastasis in patients with HCC. PMID: 27840912
- B7-H4 may be overexpressed on the majority of cells in the IDC microenvironment, including macrophages. In vitro experiments revealed that M1 and M2 cells expressed B7-H4. Compared with M1 cells, M2 cells exhibited significantly higher expression levels of B7-H4. PMID: 27430170
- wortmannin and rapamycin inhibit B7-H4-mediated tumor immunoresistance through regulating B7-H4 subcellular distribution. Taken together, these results suggest that PI3K/Akt/mTOR inhibitors might be used for adjuvant therapy aimed at inhibition of immune evasion. PMID: 28064317
- Unstable cell surface antigens are not suitable as targets for ADCC, and we therefore performed an indirect ADCC-redirecting T-cell cytotoxicity assay to study B7-H4 using polyclonal anti-mouse IgG antibody-mediated linking. PMID: 27632942
- Knockdown of B7-H4 increased CD8+ T cell-mediated cytotoxicity in vitro. PMID: 27177355
- study provided the first evidence that B7-H4 facilitated esophageal squamous cell carcinoma cell proliferation through promoting IL-6/STAT3 positive loopback pathway activation PMID: 27088889
- B7H4 antigen is a negative prognostic marker for pancreatic cancer patients and also seems to express resistance of pancreatic cancer patients to chemotherapy with gemcitabine. PMID: 25924930
- B7-H3 and B7-H4 are involved in esophageal squamous cell carcinoma (ESCC) progression and development and their coexpression could be valuable prognostic indicators. PMID: 26411671
- study suggest that serum B7-H4 is an independent prognostic indicator for HCC and may be a promising biomarker for early diagnosis as well as disease prognosis of HCC. PMID: 26505457
- Data show that disrupted control of costimulation, evidenced by VTCN1 loss in both APCs and pancreatic islets, ultimately results in altered balance of control of immune responses. PMID: 26773144
- Studied VTCN1 gene polymorphisms in susceptibility to Breast Cancer. PMID: 25385143
- Data indicate that the diagnostic efficiency of V-set domain containing T cell activation inhibitor 1 (sB7-H4) combined carcinoembryonic antigen (CEA) was superior to either sB7-H4 or CEA. PMID: 26301886
- In human amniotic fluid stem cells, the negative co-stimulatory molecule B7H4 regulates low immunogenicity, which can provide a modest inflammatory reaction microenvironment for wound repair. PMID: 26101181
- In women who underwent elective cesarian section, a significant increase in sB7-H4 serum levels occurred postpartal, while in women who experienced spontaneous onset of labor, there were no differences between prepartal and postpartal levels. PMID: 25907449