Recombinant EN-TEV Protease (mutated S219 N) Protein (Tagged-His Tag)
Beta LifeScience
SKU/CAT #: BLA-3775P
Recombinant EN-TEV Protease (mutated S219 N) Protein (Tagged-His Tag)
Beta LifeScience
SKU/CAT #: BLA-3775P
Collections: Enzymes, Other recombinant proteins, Protease, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Tobacco etch virus |
Accession | P04517 |
Description | Recombinant EN-TEV Protease (mutated S219 N) Protein (Tagged-His Tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | GHHHHHHHGESLFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFII TNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFP PFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKH WIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTN QEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNRRRRR |
Purity | Greater than 98% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Complete digestion of 50µg of T7 Tag-HBxAg protein using 1µg TEVenzyme (in 1/50 ratio) in either 3 hours at 37 °C or 12 hours at 4 °C.The "standard" reaction buffer for TEV protease is 50 mM Tris-HCl (pH 8.0), 0.5 mM EDTA and 1mM DTT. The duration of the cleavage reaction is typically overnight, although lots of cleavage will happen in the first few hours and prolonged incubation times may not lead to proportional increases in cleavage. TEV protease is maximally active at 34 °C, but werecommend performing the digest at room temperature (20 °C) or 4 °C. TEV protease is only three-fold less active at 4 °C than at 20 °C.Typically, a good rule of thumb for initial test of digestion is 1 µg TEV enzyme per 50 - 100µg target protein ratio. Perform a small-scale reaction first, if possible, to gauge the efficiency of processing. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |