Recombinant EBV Latent Membrane Protein 1 (His tag)
Beta LifeScience
SKU/CAT #: BLA-11513P
Recombinant EBV Latent Membrane Protein 1 (His tag)
Beta LifeScience
SKU/CAT #: BLA-11513P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Epstein-Barr virus |
Accession | P0C741 |
Synonym | BNLF1 EBV Epstein Barr virus HHV4 Human Herpesvirus 4 Latent membrane protein 1 LMP1 |
Description | Recombinant EBV Latent Membrane Protein 1 (His tag) was expressed in Yeast. It is a Protein fragment |
Source | Yeast |
AA Sequence | YFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDG PPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDP DNTDDNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGG GDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD |
Molecular Weight | 21 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. Interacts with host UBE2I and subsequently affects the sumoylation state of several cellular proteins. For example, induces the sumoylation of host IRF7 thereby limiting its transcriptional activity and modulating the activation of innate immune responses. |
Subcellular Location | Host cell membrane; Multi-pass membrane protein. |
Protein Families | Herpesviridae LMP-1 family |