Recombinant Saccharomyces Cerevisiae Inositol Phosphorylceramide Synthase Catalytic Subunit Aur1 (AUR1) Protein (His-B2M&Myc)
Beta LifeScience
SKU/CAT #: BLC-08028P
Greater than 85% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Inositol Phosphorylceramide Synthase Catalytic Subunit Aur1 (AUR1) Protein (His-B2M&Myc)
Beta LifeScience
SKU/CAT #: BLC-08028P
Collections: Fc receptors, Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Saccharomyces Cerevisiae Inositol Phosphorylceramide Synthase Catalytic Subunit Aur1 (AUR1) Protein (His-B2M&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P36107 |
Target Symbol | AUR1 |
Synonyms | AUR1; YKL004WInositol phosphorylceramide synthase catalytic subunit AUR1; IPC synthase catalytic subunit AUR1; EC 2.-.-.-; Aureobasidin A resistance protein; Phosphatidylinositol:ceramide phosphoinositol transferase |
Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
Expression System | E.coli |
Tag | N-10His-B2M&C-Myc |
Target Protein Sequence | TKYTHLPIVDTSLFCRWSYTSIEKYDISKSDPLAADSNDIESVPLSNLELDFDLNMTDEPSVSPSLFDGSTSVSRSSATSITSLGVKRA |
Expression Range | 313-401aa |
Protein Length | Partial |
Mol. Weight | 26.7 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Catalytic component of the inositol phosphorylceramide synthase which catalyzes the addition of a phosphorylinositol group onto ceramide to form inositol phosphorylceramide, an essential step in sphingolipid biosynthesis. |
Subcellular Location | Golgi apparatus, Golgi stack membrane; Multi-pass membrane protein. |
Protein Families | AUR1 family |
Database References | KEGG: sce:YKL004W STRING: 4932.YKL004W |
Gene Functions References
- Deletion of AUR1 allows cell growth, but leads to a defect in cytokinesis, which takes twice as long as in wild-type strains. PMID: 22616608
- it is suggested that the deletion of sphingolipid hydroxylases changes the toxicity of ceramide under AUR1-repressive conditions. PMID: 22166213