Recombinant Rat Synaptotagmin-2 (SYT2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02023P
Greater than 85% as determined by SDS-PAGE.
Recombinant Rat Synaptotagmin-2 (SYT2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02023P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat Synaptotagmin-2 (SYT2) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P29101 |
Target Symbol | SYT2 |
Synonyms | (Synaptotagmin II)(SytII) |
Species | Rattus norvegicus (Rat) |
Expression System | in vitro E.coli expression system |
Tag | N-10His |
Target Protein Sequence | MRNIFKRNQEPIVAPATTTATMPLAPAAPADNSTESTGTGESQEDMFAKLKDKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK |
Expression Range | 1-422aa |
Protein Length | Full Length |
Mol. Weight | 48.7 kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Exhibits calcium-dependent phospholipid and inositol polyphosphate binding properties. May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. Plays a role in dendrite formation by melanocytes.; (Microbial infection) Receptor for C.botulinum neurotoxin type B (BoNT/B, botB); unlike the case with BoNT/B interaction is not improved in the presence of gangliosides. The toxin binds to the vesicular domain of Syt2 (residues 1-61).; (Microbial infection) Receptor for C.botulinum neurotoxin type G (BoNT/G, botG); unlike the case with BoNT/B interaction is not improved in the presence of gangliosides. The toxin binds to the vesicular domain of Syt2 (residues 1-61). |
Subcellular Location | Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane; Single-pass membrane protein. Cytoplasm. |
Protein Families | Synaptotagmin family |
Database References | |
Tissue Specificity | Predominantly expressed in brain regions such as the spinal cord, brain stem and cerebellum. |
Gene Functions References
- Crystal structure of the rat Syt2 protein botulinum neurotoxin DC complex. PMID: 23932591
- Data suggest that immature medial nucleus of the trapezoid body terminals may contain two populations of synaptic vesicles, one expressing VGLUT3 with synaptotagmin 2 and another expressing VGLUT3 with synaptotagmin 1. PMID: 21456023
- Synaptotagmin II is critical for the delivery of internalized cargo for degradation. One consequence of Synaptotagmin II suppression is a delay in PKCalpha downregulation, resulting in its prolonged signaling. PMID: 12118064
- syts I and II can function as protein receptors for Botulinum neurotoxin b and mediate its entry PMID: 14504267
- both synaptotagmins I and II can interact with the syntaxin/synaptosomal-associated protein of 25 kDa (SNAP-25) dimer PMID: 14709554
- The results indicated that Syt2 played a negative regulation in exocytosis of lysosomes in RBL-2H3 cells. PMID: 16212888
- the structure of a BoNT in complex with its protein receptor: the receptor-binding domain of botulinum neurotoxin serotype B (BoNT/B) bound to the luminal domain of synaptotagmin II, determined at 2.15 A resolution PMID: 17167421
- An overexpressed mutation in Syt2 leaves intrinsic calcium sensitivity of synaptic vesicles intact while it destabilizes the readily releasable pool of vesicles. PMID: 19709630