Recombinant Rat H-2 Class Ii Histocompatibility Antigen Gamma Chain (CD74) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09974P
Greater than 90% as determined by SDS-PAGE.
Recombinant Rat H-2 Class Ii Histocompatibility Antigen Gamma Chain (CD74) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09974P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat H-2 Class Ii Histocompatibility Antigen Gamma Chain (CD74) Protein (His) is produced by our E.coli expression system. This is a extracellular protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P10247 |
Target Symbol | CD74 |
Synonyms | Cd74; H-2 class II histocompatibility antigen gamma chain; Ia antigen-associated invariant chain; Ii; MHC class II-associated invariant chain; CD antigen CD74) [Cleaved into: Class-II-associated invariant chain peptide; CLIP)] |
Species | Rattus norvegicus (Rat) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | QQQGRLDKLTVTSQNLQLENLRMKLPKSAKPVSPMRMATPLLMRPLSMDNMLQAPVKNVTKYGNMTQDHVMHLLTKSGPVNYPQLKGSFPENLKHLKNSMNGLDWKVFESWMKQWLLFEMSKNSLEEKQPTQTPPKVLTKCQEEVSHIPDVHPGAFRPKCDENGNYMPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDPSSGLGVTKQDMGQMFL |
Expression Range | 57-280aa |
Protein Length | Extracellular Domain |
Mol. Weight | 29.5kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place. Enhance also the stimulation of T-cell responses through interaction with CD44.; Binds to the peptide-binding site of MHC class II alpha/beta heterodimers forming an alpha-beta-CLIP complex, thereby preventing the loading of antigenic peptides to the MHC class II complex until its release by HLA-DM in the endosome.; Stabilizes the conformation of mature CTSL by binding to its active site and serving as a chaperone to help maintain a pool of mature enzyme in endocytic compartments and extracellular space of antigen-presenting cells (APCs). |
Subcellular Location | [Isoform Long]: Late endosome. Lysosome.; Cell membrane; Single-pass type II membrane protein. Endoplasmic reticulum membrane. Golgi apparatus, trans-Golgi network. Endosome. Lysosome. |
Database References |
Gene Functions References
- cytokine MIF was able to elicit inflammatory response of astrocytes through interaction with CD74 receptor, and activation of ERK was necessary for the intracellular signal transduction. PMID: 27926507
- Methylglyoxal induced gene expression of CD74 in the in the diabetic retina. PMID: 24974304
- Macrophage migration inhibitory factor(MIF)/CD74 interaction induces upregulation of cyclooxygenase (COX)-2 and prostaglandin E2 secretion in primary rodent microglia. PMID: 21802455
- Data indicate that intraluminal macrophage migration inhibitory factor, released from urothelial cells as a consequence of substance P treatment, interacts with urothelial cell-surface CD74. PMID: 19325914
- Intraluminal blockade of cell-surface CD74 and glucose regulated protein 78 prevents substance P-induced bladder inflammatory changes in the rat PMID: 19503733