Recombinant Rabbit Interleukin 17A (IL17A) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-10290P
Greater than 90% as determined by SDS-PAGE.
Recombinant Rabbit Interleukin 17A (IL17A) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-10290P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rabbit Interleukin 17A (IL17A) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | G1SLF2 |
Target Symbol | IL17A |
Species | Oryctolagus cuniculus (Rabbit) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA |
Expression Range | 21-153aa |
Protein Length | Partial |
Mol. Weight | 42.3kDa |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |