Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 14 (TNFRSF14) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-06076P
Greater than 95% as determined by SDS-PAGE.
Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 14 (TNFRSF14) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-06076P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 14 (TNFRSF14) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined by its ability to bind Human BTLA in functional ELISA is typically 1.17 ug/ml |
Uniprotkb | Q80WM9 |
Target Symbol | TNFRSF14 |
Synonyms | Tnfrsf14; hvem; Tumor necrosis factor receptor superfamily member 14; Herpes virus entry mediator A; Herpesvirus entry mediator A; HveA; Tumor necrosis factor receptor-like 2; TR2; CD antigen CD270 |
Species | Mus musculus (Mouse) |
Expression System | Mammalian cell |
Tag | C-hFc |
Complete Sequence | QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV |
Expression Range | 39-207aa |
Protein Length | Partial |
Mol. Weight | 45.6 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Target Details
Target Function | Receptor for four distinct ligands: The TNF superfamily members TNFSF14/LIGHT and homotrimeric LTA/lymphotoxin-alpha and the immunoglobulin superfamily members BTLA and CD160, altogether defining a complex stimulatory and inhibitory signaling network. Signals via the TRAF2-TRAF3 E3 ligase pathway to promote immune cell survival and differentiation. Participates in bidirectional cell-cell contact signaling between antigen presenting cells and lymphocytes. In response to ligation of TNFSF14/LIGHT, delivers costimulatory signals to T cells, promoting cell proliferation and effector functions. Interacts with CD160 on NK cells, enhancing IFNG production and anti-tumor immune response. In the context of bacterial infection, acts as a signaling receptor on epithelial cells for CD160 from intraepithelial lymphocytes, triggering the production of antimicrobial proteins and proinflammatory cytokines. Upon binding to CD160 on activated CD4+ T cells, downregulates CD28 costimulatory signaling, restricting memory and alloantigen-specific immune response. May interact in cis (on the same cell) or in trans (on other cells) with BTLA. In cis interactions, appears to play an immune regulatory role inhibiting in trans interactions in naive T cells to maintain a resting state. In trans interactions, can predominate during adaptive immune response to provide survival signals to effector T cells. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Tissue Specificity | Expressed at mucosal sites including colon and pulmonary epithelial cells. Expressed in naive T cells. |