Recombinant Mouse Scavenger Receptor Cysteine-Rich Type 1 Protein M130 (CD163) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09590P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Cd163.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Cd163.
Recombinant Mouse Scavenger Receptor Cysteine-Rich Type 1 Protein M130 (CD163) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09590P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Scavenger Receptor Cysteine-Rich Type 1 Protein M130 (CD163) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q2VLH6 |
Target Symbol | CD163 |
Synonyms | Cd163; M130Scavenger receptor cysteine-rich type 1 protein M130; CD antigen CD163) [Cleaved into: Soluble CD163; sCD163)] |
Species | Mus musculus (Mouse) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | VVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEGADLSLRLVDGVSRCSGRLEVRFQGEWGTVCDDNWDLRDASVVCKQLGCPTAISAIGRVNASEGSGQIWLDNISCEGHEATLWECKHQEWGKHYCHHREDAGVTCS |
Expression Range | 86-365aa |
Protein Length | Partial |
Mol. Weight | 32.2kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1.; After shedding, the soluble form (sCD163) may play an anti-inflammatory role. |
Subcellular Location | [Soluble CD163]: Secreted.; Cell membrane; Single-pass type I membrane protein. |
Database References | |
Tissue Specificity | Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen and mesenteric lymph nodes. |
Gene Functions References
- house dust mite -challenged Cd163-/- mice displayed increases in airway eosinophils and mucous cell metaplasia PMID: 26376364
- In diabetic mice, increased sCD163 at wk 5 and decreased percentage of CD163(+) monocytes at wk 10 preceded alteration in kidney collagen IV mRNA at wk 20. In vitro incubation of monocytes in anti-inflammatory glucocorticoid increased the percentage of CD163(+) monocytes. PMID: 27354410
- During ischaemia, soluble CD163 functions as a decoy receptor for TWEAK, to regulate TWEAK-induced activation of canonical nuclear factor-kappaB and Notch signalling necessary for myogenic progenitor cell proliferation. PMID: 26242746
- Data indicate an essential substrate motif for ADAM17-mediated CD163 and proTNF-alpha cleavage in macrophages. PMID: 24275664
- alpha(1)-Acid glycoprotein up-regulates CD163 via TLR4/CD14 protein pathway: possible protection against hemolysis-induced oxidative stress. PMID: 22807450
- Data show that telmisartan reduced the mRNA expression of CD11c and TNF-alpha, M1 macrophage markers, and significantly increased the expressions of M2 markers, such as CD163, CD209. PMID: 21427223
- Assignment of the CD163 antigen to mouse chromosome 6 band F2. PMID: 12698011