Recombinant Mouse Membrane Cofactor Protein (CD46) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09930P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Membrane Cofactor Protein (CD46) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09930P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Membrane Cofactor Protein (CD46) Protein (His) is produced by our E.coli expression system. This is a extracellular protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O88174 |
Target Symbol | CD46 |
Synonyms | Cd46; McpMembrane cofactor protein; CD antigen CD46 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | CELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLYLSPYLMIATCEPNHTWVPISDAGCIKVQCTMLQDPSFGKVYYIDGSFSWGARAKFTCMEGYYVVGMSVLHCVLKGDDEAYWNGYPPHCEKIYCLPPPKIKNGTHTLTDINVFKYHEAVSYSCDPTPGPDKFSLVGTSMIFCAGHNTWSNSPPECKVVKCPNPVLQNGRLISGAGEIFSYQSTVMFECLQGFYMEGSSMVICSANNSWEPSIPKCLKGPRPTHPTKPPVYNYTGYPSPREGIFSQELDAW |
Expression Range | 45-329aa |
Protein Length | Extracellular Domain |
Mol. Weight | 35.9kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May be involved in the fusion of the spermatozoa with the oocyte during fertilization. |
Subcellular Location | [Isoform 1]: Cytoplasmic vesicle, secretory vesicle, acrosome inner membrane; Single-pass type I membrane protein. Note=Inner acrosomal membrane of spermatozoa.; [Isoform 2]: Secreted. |
Database References | |
Tissue Specificity | Present only in testis (at protein level). |
Gene Functions References
- Changes in CD46 expression may lead to changes in VEGF and play a pathologic role in the development of age-related macular degeneration. PMID: 26161984
- Our findings provide evidence for expression of CD46 in the mouse eye and a role for CD46 in protection against laser-induced choroidal neovascularization PMID: 25019227
- This fusion is mediated by the interaction between viral glycoproteins expressed on the membrane of the infected cells and CD46 on the glial targets, and is also observed using cells expressing recombinant MV glycoproteins. PMID: 15920733
- CD46 isoforms function as receptors for human herpesvirus 6 and measles virus PMID: 12171934
- Disruption of mouse CD46 causes an accelerated spontaneous acrosome reaction in sperm and increased male fertility PMID: 12640142
- CD46 has a role as a receptor for fusion and entry of human herpesvirus 6 into target cells PMID: 12724329