Recombinant Mouse Gastric Inhibitory Polypeptide Receptor (GIPR) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01973P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Gastric Inhibitory Polypeptide Receptor (GIPR) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01973P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Gastric Inhibitory Polypeptide Receptor (GIPR) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q0P543 |
Target Symbol | GIPR |
Synonyms | Gipr; Gastric inhibitory polypeptide receptor; GIP-R; Glucose-dependent insulinotropic polypeptide receptor |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ |
Expression Range | 19-134aa |
Protein Length | Partial |
Mol. Weight | 20.8 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. |
Protein Families | G-protein coupled receptor 2 family |
Database References |
Gene Functions References
- The study provides evidence that the insulinotropic action of zfGIP in mammalian systems involves activation of both the GLP-1 and the GIP receptors but not the glucagon receptor PMID: 29157578
- Microarray analysis revealed that pregnancy-specific glycoprotein 17 (Psg17), a potential CD9-binding partner, was significantly decreased in GIP receptor-knockout (Gipr-/-) testes. PMID: 28430907
- GIPR signaling in adipose tissue plays a critical role in high fat diet-induced insulin resistance and hepatic steatosis in vivo, which may involve IL-6 signaling. PMID: 28096257
- Genetic deletion of both GLP-1 and GIP receptors reveals that they are required to maintain an adequate islet number in adulthood and to maintain normal beta cell responses to glucose. PMID: 27020250
- Results suggest the beneficial effects of glucose-dependent insulinotropic polypeptide on periodontal disease. PMID: 27181102
- Gipr(-/-) offspring of mice exposed to high fat diet(HFD) during pregnancy/lactation became insulin resistant and obese and exhibited increased adipose tissue inflammation and decreased peripheral tissue substrate utilization after reintroduction of HFD. PMID: 26631738
- Beta-cell Gipr KO mice exhibit lower levels of meal-stimulated insulin secretion, decreased expansion of adipose tissue mass and preservation of insulin sensitivity and decreased TCF1 expression. PMID: 26642437
- Gipr is expressed in healthy arteries, predominantly in endothelial cells. PMID: 26395740
- These data highlighted the importance of intact GIPR signalling and dietary composition in modulating memory and learning, and hippocampal pathways involved in the maintenance of synaptic plasticity PMID: 25760229
- Functional GIP receptors play a major role in islet compensatory response to high fat feeding in mice. PMID: 25688757
- our data demonstrate that the expression of GLP-1R and GIPR is regulated by glucose concentrations in MC3T3-E1 cells undergoing differentiation induced by BMP-2. PMID: 24866833
- Results show that GIPR undergoes trafficking between the plasma membrane and intracellular compartments of both GIP-stimulated and unstimulated adipocytes. PMID: 25047836
- Structural and pharmacological characterization of novel potent and selective monoclonal antibody antagonists of glucose-dependent insulinotropic polypeptide receptor. PMID: 23689510
- a role of the adipocyte GIPr in nutrient-dependent regulation of body weight and lean mass, but it does not support a direct and independent role for the adipocyte or beta-cell GIPr in promoting adipogenesis. PMID: 22027838
- Gipr is essential for adrenal steroidogenesis and links high fat (HF) feeding to increased levels of corticosterone, reduced glucocorticoid levels do not significantly contribute to the enhanced metabolic phenotypes in HF-fed Gipr(-/-) mice. PMID: 22043004
- GIPR(dn) transgenic mice show a disturbed expansion of the endocrine pancreas, due to perturbed islet neogenesis. PMID: 21818396
- GIP receptors play an important role in cognition, neurotransmission, and cell proliferation. PMID: 21273318
- Both GIPR protein and mRNA expression increased during cell differentiation, and this increase was associated with upregulation of nuclear levels of SREBP-1c and PPARgamma, as well as acetylation of histones H3/H4. PMID: 21245029
- GIPR(-/-) mice exhibit altered islet structure and topography and increased islet sensitivity to glucagon-like peptide-1 despite a decrease in pancreatic insulin content and gene expression PMID: 12540373
- Results demonstrate that glucose intolerance was additively increased during oral glucose absorption when both gastric inhibitory polypeptide receptors and glucagon-like peptide 1 receptors were inactivated. PMID: 14966573
- intact signaling of G-protein coupled receptors is involved in postnatal islet and beta-cell development and neogenesis of the pancreatic islets PMID: 15582721
- Adult GIP receptor knock-out mice exhibit a significantly lower number of newborn cells in the hippocampal dentate gyrus compared with wild-type mice. PMID: 15716418
- long term activation of the GIP receptor by daily treatment with N-AcGIP(LysPAL37) improved glucose tolerance due to enhancement of pancreatic beta cell glucose responsiveness and insulin secretion. PMID: 16181707
- Both incretins secretion depends on mechanisms involving their own receptors and GLP-1 further requires GLUT2. PMID: 17681422
- relative reduction of truncated GIPR expression may be involved in hypersensitivity of GIPR and hyperinsulinemia in diet-induced obese mice PMID: 17971513
- Double incretin receptor knockout mice exhibit enhanced insulin action compared with wild-type mice when fed a regular diet and are protected from high-fat diet-induced obesity and insulin resistance. PMID: 17977951
- Gastric inhibitory peptide receptor interacts with estrogens in the hypothalamic regulation of food intake in mice. PMID: 18505834
- Results suggest that activation of the gastric inhibitory polypeptide receptor can improve diabetes control in high-fat-fed mice. PMID: 19073224
- Analyses with GIPR-deficient mice suggest a role of GIP/GIPR signal transduction in promoting spontaneous recovery after nerve crush; injury of GIPR-deficient mouse sciatic nerve revealed impaired axonal regeneration. PMID: 19170165
- Report differential importance of glucose-dependent insulinotropic polypeptide vs glucagon-like peptide 1 receptor signaling for beta cell survival in mice. PMID: 19766644