Recombinant Mouse Fibroblast Growth Factor 5 (FGF5) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00645P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Fibroblast Growth Factor 5 (FGF5) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00645P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Fibroblast Growth Factor 5 (FGF5) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P15656 |
Target Symbol | FGF5 |
Synonyms | (FGF-5)(Heparin-binding growth factor 5)(HBGF-5) |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | HGEKRLTPEGQPAPPRNPGDSSGSRGRSSATFSSSSASSPVAASPGSQGSGSEHSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEASVLSILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQSEQPELSFTVTVPEKKKPPVKPKVPLSQPRRSPSPVKYRLKFRFG |
Expression Range | 21-264aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 32.8 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase. |
Subcellular Location | Secreted. |
Protein Families | Heparin-binding growth factors family |
Database References |
Gene Functions References
- Recruited CD11b+ CD68+ Kupffer cells/Mphis may play an essential role in steatohepatitis and fibrosis in FGF5 null mice fed with a HFD. Recruitment and activation of bone marrow derived Mphis is the key factor to develop steatohepatitis from simple steatosis. PMID: 27708340
- It participates in the progression of hepatic fibrosis. PMID: 24521867
- Interaction of mutant genes Fgf5(go-Y), we, and wal changes the duration of hair growth cycles in mice PMID: 22567929
- A deletion of a 9.3-kb region in the Fgf5 gene showed insertion of a 498-bp early transposon element long terminal repeat. Results show that long hair mutation of moja/moja mice is caused by Fgf5 disruption mediated by retrotransposon insertion. PMID: 21512271
- parathyroid hormone-related protein and fibroblast growth factor-5 regulate the anagen to catagen transition by independent pathways PMID: 12713572
- the Fgf5(go) gene is a powerful modifier of mutant genes determining the process of alopecia. PMID: 19534432