Recombinant Mouse Fibroblast Growth Factor 20 (FGF20) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06175P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Fibroblast Growth Factor 20 (FGF20) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06175P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Fibroblast Growth Factor 20 (FGF20) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q9ESL9 |
Target Symbol | FGF20 |
Synonyms | Fgf20Fibroblast growth factor 20; FGF-20 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | MAPLTEVGAFLGGLEGLSQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT |
Expression Range | 1-211aa |
Protein Length | Full Length |
Mol. Weight | 27.7 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Neurotrophic factor that regulates central nervous development and function. |
Subcellular Location | Secreted. |
Protein Families | Heparin-binding growth factors family |
Database References |
Gene Functions References
- Data show that Fibroblast Growth Factors (FGF) 9 and 20 regulate the number of cochlear progenitors. PMID: 25915623
- fibroblast growth factor 20 (Fgf20) is expressed in hair placodes and is induced by and functions downstream from epithelial ectodysplasin (Eda)/Edar and Wnt/beta-Catenin signaling to initiate formation of the underlying dermal condensation PMID: 23431057
- We hypothesized that Fgf20 plays a role in specification, amplification, or maintenance of Sox2 expression in prosensory progenitors of the developing mammalian cochlea. PMID: 22973011
- Fgf20 is a major downstream effector of ectodysplasin and affects ectodysplasin-regulated characteristics of tooth morphogenesis, including the number, size and shape of teeth. PMID: 22833125
- The data suggested that, at a minimum, Fgf9/20 and Bmp7 organize the nephron progenitor niche. FGF signaling likely regulates multiple important steps in the niche, including survival, proliferation, and competence. PMID: 22698282
- Data indicate that the viability and hearing loss in Fgf20 knockout mice suggest that FGF20 may also be a deafness-associated gene in humans. PMID: 22235191
- expression of FGF20 in calvarial and limb development PMID: 11900978
- Fgf20 is expressed at the right time and place to mediate sensory cell specification and is the likely activator/ligand of fibroblast growth factor (FGF) receptor 1 during cochlear development. PMID: 18524904