Recombinant Mouse Disintegrin And Metalloproteinase Domain-Containing Protein 12 (ADAM12) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02512P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Baculovirus-expressed Mus musculus (Mouse) Adam12.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Baculovirus-expressed Mus musculus (Mouse) Adam12.
Recombinant Mouse Disintegrin And Metalloproteinase Domain-Containing Protein 12 (ADAM12) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02512P
Collections: Enzymes, Featured enzyme molecules, Protease, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Disintegrin And Metalloproteinase Domain-Containing Protein 12 (ADAM12) Protein (His&Myc) is produced by our Baculovirus expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q61824 |
Target Symbol | ADAM12 |
Synonyms | Adam12; MltnaDisintegrin and metalloproteinase domain-containing protein 12; ADAM 12; EC 3.4.24.-; Meltrin-alpha |
Species | Mus musculus (Mouse) |
Expression System | Baculovirus |
Tag | N-10His&C-Myc |
Target Protein Sequence | ETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDTLERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAFGGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDAVCAHGQCCEDCQLKPPGTACRGSSNSCDLPEFCTGTAPHCPANVYLHDGHPCQGVDGYCYNGICQTHEQQCVTLWGPGAKPAPGICFERVNSAGDPYGNCGKDSKSAFAKCELRDAKCGKIQCQGGASRPVIGTNAVSIETNIPQQEGGRILCRGTHVYLGDDMPDPGLVLAGTKCAEGKICLNRRCQNISVFGVHKCAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQG |
Expression Range | 206-706aa |
Protein Length | Partial |
Mol. Weight | 58.4kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Involved in skeletal muscle regeneration, specifically at the onset of cell fusion. Also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors. |
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Database References | |
Tissue Specificity | Expressed during early developing mesenchymal cells that give rise to skeletal muscle, bones and visceral organs. Not expressed in adult normal muscle but expressed in regenerating muscle. |
Gene Functions References
- In conclusion, MiR29a regulates endothelial cell ADAM12 upregulation in ischemia and this is impaired in hyperglycemia. PMID: 28637396
- It was concluded that TNF-alpha-induced changes in extracellular matix components increased expression of ADAM12 among other changes that were temporally related with the onset of myocyte function. PMID: 27487498
- ADAM12 and ADAM17 are essential molecules for the impairment of barrier function of retinal vasculature under hypoxia. PMID: 26242473
- Augmentation of ADAM12 expression in vivo improved outcomes in Balb/c mice, whereas knockdown of ADAM12 made outcomes worse in C57Bl/6 mice. In vitro, ADAM12 expression modulates endothelial cell proliferation, survival, and angiogenesis. PMID: 26163448
- The effect of insulin-like growth factor-I on ADAM12 expression during the course of myogenesis is reported. PMID: 26975138
- Nitric oxide synthase deficiency has differential effects on ADAM12 expression in growing mouse brain. PMID: 25892053
- Inhibition of Erbb2 suppressed the increase in metalloproteinase ADAM12 expression in skin tumors. PMID: 24798404
- TGF-beta stimulation of renal cells results in a significant up-regulation of Adams 10, 17, 12, and 19 PMID: 24103556
- ADAM12 enhanced ephrin-A1 cleavage in response to transforming growth factor-betra1 in primary tumors. PMID: 23686306
- The endogenous SnoN plays a role in regulating ADAM12 expression in response to TGFbeta1. PMID: 20457602
- Adam12 is spatiotemporally expressed in decidualizing stromal cells in intact pregnant females and in pseudopregnant mice undergoing artificially induced decidualization. PMID: 19841944
- properly folded mouse ADAM12, after passing a rate-limiting step of exit from the ER, is processed in the secretory pathway and reaches the cell surface, where it can mediate adhesion-mediated signaling PMID: 12000744
- These observations suggest Meltrin alpha may be involved in regulating adipogenesis and myogenesis through a linked developmental pathway.We also report here the chromosomal locations of Meltrin alpha in the mouse PMID: 12482960
- Adam12 overexpression in skeletal muscle results in compenstaion for dystrophin- deficiency by increasing alpha7 integrin, utrophin and associated glycoproteins. PMID: 12915458
- Role of metalloproteinase disintegrin ADAM12 in determination of quiescent reserve cells during myogenic differentiation in vitro was studied. PMID: 12972593
- involvement of meltrin alpha in the development of obesity and in adipogenic cell proliferation. PMID: 15637293
- novel protein-protein interaction reported here involving the extracellular domain of ADAM12 may have important biological consequences during myoblast differentiation PMID: 15849365
- observations suggest that a disintegrin and metalloproteinase (ADAM)-8,-9,-10,-12,-15,and -17 play an important role in mouse uterine tissue remodelling during the oestrous cycle PMID: 15907280
- ADAM12 is a potential target for design of drugs that prevent carcinoma growth and is essential for tumor development and progression in the W10 mouse model for prostate cancer. PMID: 16607276
- endogenous ADAM9 and/or ADAM12 present in wild type mouse embryonic fibroblasts contribute to Dll1 processing PMID: 17107962
- Adam12 contributes to Tgfb signaling through interaction with the type II receptor. PMID: 17620406
- ADAM12 seemed to inhibit the satellite cell response and delay myoblast differentiation. PMID: 17982130
- Breast cancer-associated mutations interfere with the intracellular trafficking of ADAM12 and result in loss of the functional ADAM12 at the cell surface. PMID: 18241035
- Agonist signaling of both hypertension and hypertrophy depends on posttranscriptional and transcriptional mechanisms that involve MMP-7, which is transcriptionally connected with ADAM-12 PMID: 19398663
- Findings provide the first in vivo evidence that agonist-induced cardiac hypertrophy and fibrosis processes are signaled through TACE, which acts through novel pathways involving transcriptional regulation of ADAM-12 and MMP-2. PMID: 19581512