Recombinant Mouse Cathepsin W (CTSW) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04848P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Cathepsin W (CTSW) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04848P
Collections: Enzymes, Featured enzyme molecules, Protease, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Cathepsin W (CTSW) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P56203 |
Target Symbol | CTSW |
Synonyms | CtswCathepsin W; EC 3.4.22.-; Lymphopain |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | VPRTCDWRKAKNIISSVKNQGSCKCCWAMAAADNIQALWRIKHQQFVDVSVQELLDCERCGNGCNGGFVWDAYLTVLNNSGLASEKDYPFQGDRKPHRCLAKKYKKVAWIQDFTMLSNNEQAIAHYLAVHGPITVTINMKLLQHYQKGVIKATPSSCDPRQVDHSVLLVGFGKEKEGMQTGTVLSHSRKRRHSSPYWILKNSWGAHWGEKGYFRLYRGNNTCGVTKYPFTAQVDSPVKKARTSCPP |
Expression Range | 126-371aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 35.2 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May have a specific function in the mechanism or regulation of T-cell cytolytic activity. |
Subcellular Location | Endoplasmic reticulum. |
Protein Families | Peptidase C1 family |
Database References |
Gene Functions References
- mCtsW does not have a unique role in target cell apoptosis or cytotoxic cell survival in vitro. PMID: 15087452