Recombinant Mouse B-Lymphocyte Antigen Cd20 (MS4A1) Protein (His-SUMO)

Name: Recombinant Mouse B-Lymphocyte Antigen Cd20 (MS4A1) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-10239P
Price: 549.6 USD
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Car-nk targets proteins, Cluster of differentiation (cd) proteins, Featured cd protein molecules, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse B-Lymphocyte Antigen Cd20 (MS4A1) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P19437
Target Symbol	MS4A1
Synonyms	Ms4a1; Cd20; Ly-44; Ms4a2; B-lymphocyte antigen CD20; B-cell differentiation antigen Ly-44; Lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; CD antigen CD20
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Expression Range	132-291aa
Protein Length	Partial
Mol. Weight	34.1kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR.
Subcellular Location	Cell membrane; Multi-pass membrane protein. Cell membrane; Lipid-anchor.
Protein Families	MS4A family
Database References	KEGG: mmu:12482 STRING: 10090.ENSMUSP00000126422 UniGene: Mm.4046

Gene Functions References

Our findings indicate that anti-CD20-IFNalpha eradicates B-cell lymphoma by employing tumor cells as antigen-presenting cells to reactivate tumor-infiltrating CD8(+) T cells and synergizing with anti-PD-L1 treatment PMID: 28533311
Galectin-1 has a role in driving lymphoma CD20 immunotherapy resistance in a mouse model PMID: 26888257
Results indicate that an antigen-specific B cell response towards intracellular pathogens can be generated during anti-CD20 depletion therapy. PMID: 26261496
this study demonstrates a role for CD20 in B cell activation and T-dependent humoral immunity. PMID: 23966626
CD20 is required for store-operated calcium entry in C2C12 myoblasts. PMID: 22982241
immunization of mice with the CD20 extracellular domain-6 using Freund's or QS-21 adjuvants was shown to exert significant biological effects in vivo with the pronounced depletion of splenic B cells. PMID: 20189250
type I CD20 antibody cytotoxicity critically depends on Fc receptor ITAM signaling PMID: 20354182
CD20 deficiency in humans results in impaired T cell-independent antibody responses. PMID: 20038800
review of structure, function, tissue and cell distribution PMID: 12144126
Anti-CD20 antibodies rapidly depleted the vast majority of circulating and tissue B cells in an isotype-restricted manner dependent on effector cell Fc receptor expression. PMID: 15210744
expression in bacterial cells; isolation and biophysical and structural studies PMID: 16285718
In mice treated with anti-CD20 mAb, development of arthritis was significantly reduced in comparison to control mAb-treated mice PMID: 18354225
involvement of CD20 in calcium influx PMID: 18474602

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.