Recombinant Mouse B-Lymphocyte Antigen Cd20 (MS4A1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10239P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse B-Lymphocyte Antigen Cd20 (MS4A1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10239P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse B-Lymphocyte Antigen Cd20 (MS4A1) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P19437 |
Target Symbol | MS4A1 |
Synonyms | Ms4a1; Cd20; Ly-44; Ms4a2; B-lymphocyte antigen CD20; B-cell differentiation antigen Ly-44; Lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; CD antigen CD20 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP |
Expression Range | 132-291aa |
Protein Length | Partial |
Mol. Weight | 34.1kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. Cell membrane; Lipid-anchor. |
Protein Families | MS4A family |
Database References |
Gene Functions References
- Our findings indicate that anti-CD20-IFNalpha eradicates B-cell lymphoma by employing tumor cells as antigen-presenting cells to reactivate tumor-infiltrating CD8(+) T cells and synergizing with anti-PD-L1 treatment PMID: 28533311
- Galectin-1 has a role in driving lymphoma CD20 immunotherapy resistance in a mouse model PMID: 26888257
- Results indicate that an antigen-specific B cell response towards intracellular pathogens can be generated during anti-CD20 depletion therapy. PMID: 26261496
- this study demonstrates a role for CD20 in B cell activation and T-dependent humoral immunity. PMID: 23966626
- CD20 is required for store-operated calcium entry in C2C12 myoblasts. PMID: 22982241
- immunization of mice with the CD20 extracellular domain-6 using Freund's or QS-21 adjuvants was shown to exert significant biological effects in vivo with the pronounced depletion of splenic B cells. PMID: 20189250
- type I CD20 antibody cytotoxicity critically depends on Fc receptor ITAM signaling PMID: 20354182
- CD20 deficiency in humans results in impaired T cell-independent antibody responses. PMID: 20038800
- review of structure, function, tissue and cell distribution PMID: 12144126
- Anti-CD20 antibodies rapidly depleted the vast majority of circulating and tissue B cells in an isotype-restricted manner dependent on effector cell Fc receptor expression. PMID: 15210744
- expression in bacterial cells; isolation and biophysical and structural studies PMID: 16285718
- In mice treated with anti-CD20 mAb, development of arthritis was significantly reduced in comparison to control mAb-treated mice PMID: 18354225
- involvement of CD20 in calcium influx PMID: 18474602