Recombinant Klebsiella Pneumoniae Outer Membrane Protein Assembly Factor Bama (BAMA) Protein (His-B2M&Myc)
Beta LifeScience
SKU/CAT #: BLC-08949P
Greater than 90% as determined by SDS-PAGE.
Recombinant Klebsiella Pneumoniae Outer Membrane Protein Assembly Factor Bama (BAMA) Protein (His-B2M&Myc)
Beta LifeScience
SKU/CAT #: BLC-08949P
Collections: Fc receptors, Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Klebsiella Pneumoniae Outer Membrane Protein Assembly Factor Bama (BAMA) Protein (His-B2M&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | B5Y1J4 |
Target Symbol | BAMA |
Synonyms | bamA; yaeT; KPK_4543Outer membrane protein assembly factor BamA |
Species | Klebsiella pneumoniae (strain 342) |
Expression System | E.coli |
Tag | N-10His-B2M&C-Myc |
Target Protein Sequence | FVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDDDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEG |
Expression Range | 24-172aa |
Protein Length | Partial |
Mol. Weight | 33.3kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamD, the core component of the assembly machinery. |
Subcellular Location | Cell outer membrane. |
Protein Families | BamA family |
Database References | KEGG: kpe:KPK_4543 |