Recombinant Human T-Cell Antigen Cd7 (CD7) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09690P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human T-Cell Antigen Cd7 (CD7) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09690P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human T-Cell Antigen Cd7 (CD7) Protein (His) is produced by our Yeast expression system. This is a extracellular protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P09564 |
| Target Symbol | CD7 |
| Synonyms | CD7; CD7 antigen (p41); CD7 antigen; CD7 molecule; CD7_HUMAN; GP40; LEU 9; LEU9; p41 protein; T cell antigen CD7; T cell leukemia antigen ; T cell surface antigen Leu 9; T-cell antigen CD7; T-cell leukemia antigen; T-cell surface antigen Leu-9; Tp 40; Tp40; TP41 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP |
| Expression Range | 26-180aa |
| Protein Length | Extracellular Domain |
| Mol. Weight | 18.4kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Not yet known. |
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Database References |
Gene Functions References
- in acute myeloid leukemia patients the association of CD7 positivity and FLT3 positivity was found to be significant PMID: 25679063
- Data show that CD7 promotes extramedullary involvement of the B-ALL line Tanoue in an integrin beta2-dependent manner. PMID: 24920488
- We showed that the CADM1 versus CD7 plot is capable of discriminating clonally expanding HTLV-I-infected cells in indolent and acute-type T-cell leukemia-lymphomas and in asymptomatic carriers PMID: 24727323
- CD7 is present on monocytes and tumor macrophages and its ligand, SECTM1, is frequently expressed in corresponding melanoma tissues PMID: 24157461
- SECTM1 secreted from bone marrow stromal cells may interact with CD7 to influence GM-CSF expression in leukemic cells. PMID: 24211252
- epigenetic down-regulation of CD7 is associated with acute myeloid leukemia. PMID: 20398252
- CD7 loss in aggressive natural killer-cell leukemia; a useful diagnostic marker PMID: 20046078
- low expression in T-cell lymphomas due to Twist2-mediated suppression of promoter activity; enhanced by histone deacetylase inhibitors PMID: 19937140
- These findings indicate a link between epigenetic modifications and CD7 expression in primitive chronic myeloid leukemia cells. PMID: 20175919
- CD7 expression in hematopoitic cells denotes commitment to B-cell and natural killer cells lineages. PMID: 12393702
- Association of T cell antigen CD7 with type II phosphatidylinositol-4 kinase, a key component in pathways of inositol phosphate turnover. PMID: 12594831
- a novel fusion protein, designated scFvCD7:sFasL is designed to have leukemia-restricted activity. PMID: 16332967
- Patients expressing CD7 had significant shorter disease free (DFS) and post-remission survivals (PRS) than patients without CD7 (DFS of 12 months versus 42 months, P=0.005; PRS of 15 months versus 33 months, P=0.013). PMID: 16837044
- CD7 antigen notably expresses in lung microvascular endothelial cells (LME) and that it acts as an Fc receptor for IgM in LME cells. PMID: 16990185
- HTLV-IInfected cells acquired a profound decrease of intracellular calcium levels in response to ionomycin, timely correlated with decreased CD7 expression PMID: 17287851
- differential levels of CD7 identify the progressive stages of lineage commitment in human thymus, initiated from a primitive CD7(-) lympho-myeloid thymic progenitor PMID: 17959857
- close association of aberrant CD7 expression and FLT3/ITD mutation in the myeloblasts of FLT3/ITD+ acute myeloid leukemia suggests that FLT3/ITD- mediated leukemic transformation occurs in the more early stage of myeloid progenitor cells PMID: 18343790
- The CD7 expression in CD4(+) T cells discriminates between HL and reactive LAD, suggesting that this could be a useful and practical adjunctive tool in the diagnosis of Hodgkin lymphoma. PMID: 18956470
- by down-regulating CD7, ATLL cells could have escaped Gal-3-induced apoptosis to run a more aggressive clinical course PMID: 19207946
- the galectin-1 glycoprotein receptor CD7 maybe a novel target for GdA on T cells. PMID: 19683346
