Recombinant Human Sialic Acid-Binding Ig-Like Lectin 15 (SIGLEC15) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02956P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Sialic Acid-Binding Ig-Like Lectin 15 (SIGLEC15) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02956P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Sialic Acid-Binding Ig-Like Lectin 15 (SIGLEC15) Protein (His) is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q6ZMC9 |
Target Symbol | SIGLEC15 |
Synonyms | CD33 antigen-like 3; CD33 molecule-like 3; CD33L3; HsT1361; Sialic acid-binding Ig-like lectin 15; SIG15_HUMAN; Siglec-15; SIGLEC15 |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | N-6His |
Target Protein Sequence | FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST |
Expression Range | 20-263aa |
Protein Length | Partial |
Mol. Weight | 30.6kDa |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Binds sialylated glycoproteins. |
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Protein Families | Immunoglobulin superfamily, SIGLEC (sialic acid binding Ig-like lectin) family |
Database References | |
Tissue Specificity | Expressed in macrophage and/or dendritic cells of spleen and lymph nodes. |
Gene Functions References
- Siglec-15 recognizes the tumoral sTn antigen and transduces a signal for enhanced TGF-beta secretion in TAMs PMID: 23035012