Recombinant Human PADI2 / PAD2 Protein
Beta LifeScience
SKU/CAT #: BLA-6594P
Recombinant Human PADI2 / PAD2 Protein
Beta LifeScience
SKU/CAT #: BLA-6594P
Collections: Enzymes, Other enzymes, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9Y2J8 |
Synonym | KIAA0994 OTTHUMP00000044625 PAD 2 PAD H19 PAD-H19 PAD2 PADI 2 Padi2 PADI2 protein PADI2_HUMAN PDI 2 PDI2 Peptidlyarginine deiminase type II Peptidyl arginine deiminase II Peptidyl arginine deiminase type II Peptidylarginine deiminase II Protein arginine deiminase Protein arginine deiminase type 2 Protein arginine deiminase type II Protein-arginine deiminase type II Protein-arginine deiminase type-2 |
Description | Recombinant Human PADI2 / PAD2 Protein was expressed in Baculovirus infected Sf9 cells. It is a Full length protein |
Source | Baculovirus infected Sf9 cells |
AA Sequence | MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWV EVVRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDE EGSIPIDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASWTWGPEGQGAI LLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEI VLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLF FVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMT PNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRW IQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPL FESVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPLSGGRRMTKVVR DFLKAQQVQAPVELYSDWLTVGHVDEFMSFVPIPGTKKFLLLMASTSACY KLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQENLYFQRCL DWNRDILKKELGLTEQDIIDLPALFKMDEDHRARAFFPNMVNMIVLDKDL GIPKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVH CGTNVRRKPFTFKWWHMVP |
Molecular Weight | 77 kDa including tags |
Purity | >= 61% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | -‰¥19 pmole/min/µg |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Catalyzes the deimination of arginine residues of proteins. |
Subcellular Location | Cytoplasm. |
Protein Families | Protein arginine deiminase family |
Database References | |
Tissue Specificity | Detected in keratinocytes in epidermis (at protein level). |
Gene Functions References
- the mRNA expression of PADI2, PADI4 and Sp1 is upregulated in rheumatoid arthritis bone marrow CD34+ cells independently of the systemic inflammation or treatment regimen. PMID: 29148420
- These data suggest that overexpression of the human PAD2 transgene in the epidermis of transgenic mice increases the malignant conversion rate of benign tumors by promoting an inflammatory microenvironment. PMID: 28766045
- Brain gene expression of PADI2, ZNF385A, PSD2, and A2ML1 and DNA methylation dysregulations are implicated in the alteration of brain tissue properties associated with late-life cognitive decline above and beyond the influence of common neuropathologic conditions. PMID: 29084334
- Peptidyl arginine deiminase 2 (PADI2) is required for activation of androgen receptor (AR) signaling under androgen-deprived condition. PMID: 28819028
- Data suggest that protein-arginine deiminase 2 (PADI2) suppresses the proliferation of colonic epithelial cells through catalysis of protein citrullination, and that downregulation of PADI2 expression might therefore contribute to colon carcinogenesis. PMID: 28403548
- Downregulation of PADI2 is an early event in the pathogenesis of colorectal cancer associated with poor prognosis and points toward a possible role of citrullination in modulating tumor cells and their microenvironment. PMID: 27280713
- Multiple proteins citrullinated by hypoxia-induced PADs were identified. In addition, the extracellular domain of vascular endothelial growth factor receptor 2 was citrullinated by human PAD2 in vitro. CONCLUSION: Our data may contribute to understanding of pathophysiology of malignant gliomas from the aspects of protein citrullination. PMID: 27818200
- Deimination of myelin basic protein (MBP) by peptidylarginine deiminase (PAD) prevents its binding to the proteasome and decelerates its degradation by the proteasome in mammalian cells. Potential anticancer drug tetrazole analogue of chloramidine 2, at concentrations greater than 1 microM inhibits the enzymatic activity of PAD in vitro. PMID: 27599511
- this study shows that a miR-4728 downregulates PADI2, a novel rheumatoid arthritis risk gene PMID: 26927695
- We identified the presence of PADI3 mRNA expression in synovial tissue and PADI2 and PADI4 mRNA expressions in fibroblast-like synoviocytes from patients with rheumatoid arthritis. PMID: 26255191
- Protein arginine deiminase 2 binds six calcium ions in an ordered fashion. PMID: 25621824
- PAD2 activity was significantly higher in cell-free synovial fluid of rheumatoid arthritis patients compared to osteoarthritis patients. PMID: 26245941
- PAD2 activity was detected in synovial fluid samples from patients with rheumatoid arthritis. PMID: 25475141
- Report increased levels of extracellular PAD2 in the lungs of smokers. PMID: 25897949
- PADI2 and vimentin participate in the apoptotic mechanisms of activated T lymphocytes. PMID: 24850148
- these studies provide the first genetic evidence that PAD2 functions as an oncogene and suggest that PAD2 may promote tumor progression by enhancing inflammation within the tumor microenvironment. PMID: 25213324
- PAD2 appears to use a substrate-assisted mechanism of catalysis in which the positively charged substrate guanidinium depresses the pKa of the nucleophilic cysteine PMID: 24989433
- Data suggest peptidylarginine deiminase 2 (PAD2) as a possible biomarker in various inflammatory diseases. PMID: 24384061
- PAD2 and PAD4 have distinct substrate specificities. PMID: 24594197
- These findings suggest that PAD2 and citrullinated proteins may play a key role in the brain pathology of prion diseases. [review] PMID: 23022892
- Our observations show increased levels of protein deimination but not PAD2 in age related macular degeneration retinas and retinal pigment epithelium suggesting reduced rate of turnover of deiminated proteins. PMID: 23562679
- PAD2 binds directly to the promoters of the PTN and MAGEA12 genes and that the likely mechanism by which PAD2 regulates expression of these genes is via citrullination of arginine residues 2-8-17 on histone H3 tails. PMID: 22911765
- Contact between stimulated T cells and monocyte-macrophages or cytokine-activated monocyte-macrophages constitutes a highly likely source of PAD2 and PAD4, which are observed in inflamed synovial tissues. PMID: 22614825
- Normal human and canine mammary epithelium showed strong cytoplasmic and nuclear expression of PAD2, but there was reduced PAD2 expression in mammary carcinomas from both species. PMID: 22520816
- 17beta-estradiol stimulation induces the recruitment of PAD2 to target promoters by ERalpha, whereby PAD2 then citrullinates H3R26, which leads to local chromatin decondensation and transcriptional activation. PMID: 22853951
- Defective regulation of PAD2 in the periphery blood, without the immunological shelter of the blood-brain barrier, may contribute to the development of the autoimmune responses in MS. PMID: 21878453
- This is the first report demonstrating that like in primary open angle glaucoma, normal tension glaucoma also possesses elevated levels of both PAD2 and protein-bound citrulline. PMID: 20806090
- PAD2 activation and aberrant citrullinated proteins could play a role in pathogenesis and have value as a marker for the postmortem classification of neurodegenerative diseases. PMID: 20013286
- PADI2 does not contribute to genetic susceptibility to schizophrenia. PMID: 19478818
- PAD2 is expressed in human monocytic leukaemia THP-1 cells during differentiation into macrophages PMID: 19564157
- molecular cloning and gene organization; expressed by all the living epidermal layers, suggesting that PAD type II is functionally important during terminal differentiation of epidermal keratinocytes PMID: 12392711
- first report to demonstrate a measurable response in the amounts of peptidylarginine deiminase type II mRNA, protein and activity in human astrocytes by prolonged hypoxic exposure PMID: 15555572
- hPADI2 and hPADI4 have different roles under physiological and pathological conditions PMID: 15629448
- The amount of peptidyl arginine deiminase type II enzyme and citrullinated myelin basic protein was increased in multiple sclerosis PMID: 17469138
- PAD-2 & PAD-4 are only isotypes expressed in synovial tissue in rheumatoid arthritis & other arthritides; inflammatory cells are major source, but PAD-4 also comes from hyperplastic synoviocytes; both isotypes probably involved in citrullination of fibrin PMID: 17968929
- These data provide new structure-function dimensions for chemokines in leukocyte mobilization, disclosing an anti-inflammatory role for PAD. PMID: 18645041
- The citrullinating enzyme PAD-4 was detected in synovial fluid from patients with rheumatoid arthritis and spondylarthritides. PMID: 18668562
- Results describe the in vitro kinetic properties of the human peptidylarginine deiminase isoform 2 (hPAD2), and explore the putative inhibitory action of the methyl ester side chain of paclitaxel. PMID: 18923545