Recombinant Human Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 5 (LILRA5) Protein (His-Myc)
Beta LifeScience
SKU/CAT #: BLC-08616P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 5 (LILRA5) Protein (His-Myc)
Beta LifeScience
SKU/CAT #: BLC-08616P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 5 (LILRA5) Protein (His-Myc) is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | A6NI73 |
Target Symbol | LILRA5 |
Synonyms | CD85; CD85 antigen-like family member F; CD85f; ILT-11; ILT11; Immunoglobulin like transcript 11 protein; Immunoglobulin-like transcript 11; Leukocyte Ig like receptor 9; Leukocyte immunoglobulin like receptor subfamily A (with TM domain) member 5; Leukocyte immunoglobulin-like receptor 9; Leukocyte immunoglobulin-like receptor subfamily A member 5; Leukocyte immunoglobulin-like receptor subfamily B (with TM and ITIM domains) member 7; LILRA5; LILRB7; LIR-9; LIR9; LIRA5_HUMAN |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | N-6His-Myc |
Target Protein Sequence | GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR |
Expression Range | 42-268aa |
Protein Length | Partial |
Mol. Weight | 29.2kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein.; [Isoform 3]: Secreted. |
Database References | |
Tissue Specificity | Expressed mostly in tissues of the hematopoietic system, including bone marrow, spleen, lymph node and peripheral leukocytes. Among leukocytes, monocytes and neutrophils express the highest level. Expressed in CD14+ monocytes, but not in T-cells, B-cells |
Gene Functions References
- Observational study of gene-disease association. (HuGE Navigator) PMID: 20331378
- LILRA5/LIR9/ILT11 does not play a role in any MHCI recognition but could possibly bind to non-MHCI ligand(s) on the target cells to provide a novel immune regulation mechanism PMID: 16675463