Recombinant Human Inducible T-Cell Costimulator (ICOS) Protein (Fc)
Beta LifeScience
SKU/CAT #: BLC-07660P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Inducible T-Cell Costimulator (ICOS) Protein (Fc)
Beta LifeScience
SKU/CAT #: BLC-07660P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Inducible T-Cell Costimulator (ICOS) Protein (Fc) is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9Y6W8 |
Target Symbol | ICOS |
Synonyms | Activation-inducible lymphocyte immunomediatory molecule |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-FC |
Target Protein Sequence | EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKF |
Expression Range | 21-141aa |
Protein Length | Partial |
Mol. Weight | 42.7 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Enhances all basic T-cell responses to a foreign antigen, namely proliferation, secretion of lymphokines, up-regulation of molecules that mediate cell-cell interaction, and effective help for antibody secretion by B-cells. Essential both for efficient interaction between T and B-cells and for normal antibody responses to T-cell dependent antigens. Does not up-regulate the production of interleukin-2, but superinduces the synthesis of interleukin-10. Prevents the apoptosis of pre-activated T-cells. Plays a critical role in CD40-mediated class switching of immunoglobin isotypes. |
Subcellular Location | [Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted. |
Database References | |
Associated Diseases | Immunodeficiency, common variable, 1 (CVID1) |
Tissue Specificity | Activated T-cells. Highly expressed on tonsillar T-cells, which are closely associated with B-cells in the apical light zone of germinal centers, the site of terminal B-cell maturation. Expressed at lower levels in thymus, lung, lymph node and peripheral |
Gene Functions References
- ICOS (-693A/G) gene polymorphism is associated with Colon Cancer Risk. PMID: 29580042
- The altered soluble (s)PD1 and sICOS serum levels in the different Hepatitis b (HBV) groups may reflect the dysregulation of T cell activation, and may be associated with the HBV pathological process. PMID: 28983583
- we have found an association between chronic spontaneous urticaria and polymorphisms in the ICOS gene. To our knowledge, this report is the fi rst to suggest and initially indicate a possible association of the ICOS rs6726035 TT genotype with CSU pathogenesis. PMID: 28940644
- Suggest that genetic polymorphisms of ICOS function as sex-dependent risk factors for development of acute rejection in an Iranian kidney transplant population. PMID: 28031007
- Binding of NUFIP2 to Roquin promotes recognition and regulation of ICOS mRNA. PMID: 29352114
- OX40 and ICOS act in a cooperative, nonredundant manner to maximize and prolong the T follicular helper cell response that is generated after acute virus infection PMID: 27895177
- High ICOS expression is associated with colorectal neoplasms. PMID: 27197182
- This is the first replication association study of rs4325730 upstream of ICOS with AIH in the Japanese population and rs4325730G is a risk allele. PMID: 27974812
- the induction pathway of ICOS(+) Foxp3(+) cells was analyzed PMID: 27756099
- ratio of ICOS(+) /PD-1(+) Tfh cells and the frequency of IL-21(+) Tfh cells may be indicators for evaluating the idiopathic membranous nephropathy development PMID: 26845249
- Follicular helper T cells differentiation is a multistage process involving BCL6 and other transcription factors, cytokines, and costimulation through ICOS and several other molecules. (Review) PMID: 26120879
- novel deletion mutation in Pakistani siblings presents in childhood with a combined Immunodeficiency associated with an enteritis, hepatitis and impaired antiviral immunity PMID: 26399252
- findings show Tregs from inflamed lung of sarcoidosis patients characterized by ICOS(high) phenotype; high-level ICOS expression was restricted to Tregs from inflamed lung and was absent in blood Tregs of sarcoidosis patients and in lung and blood Tregs of healthy volunteers; potential implication of ICOS/ICOS-L immune-regulatory axis in in disease activity and resolution PMID: 26415669
- findings indicated that circulating memory Tfh cells, especially CCR7+ICOS+ memory Tfh cells, may be associated with the relapse of MS and may serve as a new therapeutic target PMID: 26231034
- Expression of mutant caspase-9 correlated with a downregulation of BAFFR (B-cell-activating factor belonging to the TNF family (BAFF) receptor) in B cells and ICOS (inducible T-cell costimulator) in T cells. PMID: 25569260
- This study found that ICOS rs1559931 SNP was associated with decreased hepatitis B virus-related hepatocellular carcinoma risk in the studied Chinese Han population, except for patients with natural clearance of hepatitis B virus. PMID: 26074057
- Thymus medullary epithelial cells promote regulatory T-cell generation by stimulating interleukin-2 production via ICOS. PMID: 25210803
- Data indicate that T cells redirected with an inducible T-cell costimulator ICOS-based chimeric antigen receptors CAR maintained a core molecular signature characteristic of TH17 cells. PMID: 24986688
- Increased numbers of circulating ICOS(+) and IL-21(+) Tfh and CD38(+) plasma cells may be exhibited by patients with recent diagnoses of primary biliary cirrhosis. PMID: 25404409
- Aberrant sPD1 and sICOS serum levels may reflect the dysregulation of Tcell activation, and are associated with the pathological injury of chronic HCV infection. PMID: 23426717
- Data indicate that Tregs and its inducible costimulatory molecule (ICOS+) subsets are decreased in patients with myocardial infarction (MI) and stable angina (SA). PMID: 22426168
- Data indicate the expression of programmed cell death protein 1 (PD-1), inducible T-cell Costimulator (ICOS), Cytotoxic T-Lymphocyte Antigen 4 (CTLA-4) and T cell immunoglobulin and mucin protein 3 (Tim-3) in T-cells from geriatric and younger subjects. PMID: 24083425
- The associations between costimulatory molecule gene polymorphisms including: CTLA4, PD-1, ICOS and CD28 with active cytomegalovirus (CMV) infection were evaluated in hematopoietic stem cell transplant patients. PMID: 24057239
- The acquisition of B cell stimulating properties by naive cord blood CD4 T cells required the STAT3-dependent expression of ICOS and IL-21. PMID: 23923047
- SNPs of ICOS showed no association with Hashimoto thyroiditis. PMID: 23138463
- In a transgenic graft-vs-host disease (GVHD)model, mouse CD4 T cells depend more heavily on ICOS/phosphatidylinositol 3-kinase (PI3K) signaling axis, whereas CD8 T cells are able to induce GVHD utilizing PI3K-independent ICOS signaling mechanisms. PMID: 23729441
- A molecular and computational diagnostic approach identifies FOXP3, ICOS, CD52 and CASP1 as the most informative biomarkers in acute graft-versus-host disease. PMID: 22491736
- Results suggest that the serum level of sICOS is increased in patients with diffuse cutaneous SSc and correlates with the severity and activity of skin sclerosis and interstitial lung disease. PMID: 23053221
- Augmented ICOS signalling may contribute to the pathogenesis of systemic sclerosis during early progressive disease. Soluble ICOS levels may be used as a serum marker for the activity and severity of systemic sclerosis. PMID: 23024058
- ICOS-Fc inhibited the adhesion of both dendritic cells to vascular and lymphoid endothelial cells, their migratory activity, and the expression of the Rac-1 activator beta-Pix involved in cell motility. PMID: 23275603
- ICOS expression on CD4 + CD45RO + and CD8 + CD4RO + T cells was significantly increased in systemic lupus erythmetaous (SLE) patients. ICOS expression in lupus nephritis patients was higher than in SLE patients without lupus nephritis. PMID: 21479882
- Genetic variation in ICOS gene is associated with acute rejection of liver transplantation. PMID: 22579879
- ICOS gene polymorphisms may affect the risk of breast cancer and show that some SNPs are associated with breast cancer characteristics in a northern Chinese population. PMID: 21917182
- The constellation of specific alleles in CTLA-4, CD28, and ICOS genes contributes to the susceptibility and clinical course of non-small-cell lung cancer. PMID: 21669243
- Increased quantities of inducible costimulator-positive Tregs may influence IgG4 production in IgG4-related autoimmune pancreatitis. PMID: 21926547
- NPM-ALK induces expression of the growth-promoting receptor ICOS. PMID: 21765024
- ICOS polymorphisms was significantly different in pemphigus and suggest that genetically determined abnormal function of costimulatory receptors in T cells may be associated with the pathogenesis of pemphigus PMID: 21084022
- circulating neoplastic T cells correspond more often to a CD10-positive subset than to an ICOS-positive subset in Angioimmunoblastic T-cell lymphoma PMID: 21499231
- This indicates that the investigated ICOS polymorphisms do not modulate the risk of B-CLL in the Polish population, but are associated with disease dynamics, in particular with the time to Rai stage progression. PMID: 21526489
- we found a trend for reduced expression of ICOS after gluten-free diet treatment in the intestine of celia disease children. PMID: 21288140
- polymorphisms of three major genes involved in the regulation of immune response, CTLA4, CD28 and ICOS might be involved in development of the clinical variables of IgAN PMID: 21677403
- these data suggest that preeclampsia is associated with ICOS, but is not associated with the CTLA-4 or CD28 gene polymorphisms. PMID: 21160481
- Report the role of ICOS in allergen-induced T cell activation in allergic asthma and rhinitis. PMID: 21356099
- these results suggest that the polymorphisms in the CD28, CTLA4 and ICOS genes at least do not modulate risk of melanoma and nor do those influence the disease prognosis in the investigated population. PMID: 19672595
- In active ulcerative colitis CD86 and ICOS were over-expressed in the intestinal epithelial cells and lamina propria mononuclear cells. PMID: 20388394
- Increased amount of CD86 or ICOS positive lamina propria mononuclear cells and enterocytes suggests that co-stimulatory molecules may play a role in the pathogenesis of Crohn disease. PMID: 20019769
- Results reveal a vital role for ICOS signaling in the generation and maintenance of human T(H)17 cells and suggest that components of this pathway could be therapeutically targeted to treat cancer or chronic infection. PMID: 20980695
- High ICOS expression is associated with lymphomas of T follicular helper cell. PMID: 20207847
- The rs6726035 in ICOS was significantly associated with RA, Comparing the genotype frequencies in the codominant model (CC vs. CT, CC vs. TT) in the rs6726035 SNP revealed that the C allele appeared to be decreased in patients with RA patients. PMID: 20113255
- ICOS polymorphisms were not associated with susceptibility to cervical squamous cell (CSCC) and with histologic grade of CSCC. PMID: 19913589