Recombinant Human IDH1 Protein
Beta LifeScience
SKU/CAT #: BLA-4793P
Recombinant Human IDH1 Protein
Beta LifeScience
SKU/CAT #: BLA-4793P
Collections: Enzymes, Other enzymes, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O75874 |
Synonym | Cytosolic NADP isocitrate dehydrogenase Cytosolic NADP-isocitrate dehydrogenase Epididymis luminal protein 216 Epididymis secretory protein Li 26 HEL-216 HEL-S-26 ICDH IDCD IDH IDH1 IDHC_HUMAN IDP IDPC Isocitrate dehydrogenase (NADP(+)) 1 cytosolic Isocitrate dehydrogenase [NADP] cytoplasmic Isocitrate dehydrogenase 1 (NADP+) soluble NADP dependent isocitrate dehydrogenase cytosolic NADP dependent isocitrate dehydrogenase peroxisomal NADP(+)-specific ICDH Oxalosuccinate decarboxylase PICD |
Description | Recombinant Human IDH1 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMSKKISGGSVVEMQGDEMTRIIWELIKEKL IFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATITPDE KRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIII GRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEI YDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDS VAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPI ASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACI KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL |
Molecular Weight | 49 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Specific activity: > 0.7 units/ml. One unit will convert 1.0 umole of isocitrate to alpha-ketoglutarate per minute at pH7.5 at 25C. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |