Recombinant Human High Affinity Immunoglobulin Epsilon Receptor Subunit Gamma (FCER1G) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08625P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human High Affinity Immunoglobulin Epsilon Receptor Subunit Gamma (FCER1G) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08625P
Collections: Fc receptors, Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human High Affinity Immunoglobulin Epsilon Receptor Subunit Gamma (FCER1G) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P30273 |
Target Symbol | FCER1G |
Synonyms | Fc fragment of IgE; high affinity I; receptor for; gamma polypeptide; Fc receptor gamma chain; Fc-epsilon RI-gamma; FCER1G; FCERG_HUMAN; FceRI gamma; FCRG; FcRgamma; High affinity immunoglobulin epsilon receptor subunit gamma; IgE Fc receptor subunit gamma; Immunoglobulin E receptor; high affinity; gamma chain |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ |
Expression Range | 19-86aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 34.8kDa |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Adapter protein containing an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors. As a component of the high-affinity immunoglobulin E (IgE) receptor, mediates allergic inflammatory signaling in mast cells. As a constitutive component of interleukin-3 receptor complex, selectively mediates interleukin 4/IL4 production by basophils, priming T-cells toward effector T-helper 2 subset. Associates with pattern recognition receptors CLEC4D and CLEC4E to form a functional signaling complex in myeloid cells. Binding of mycobacterial trehalose 6,6'-dimycolate (TDM) to this receptor complex leads to phosphorylation of ITAM, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes. May function cooperatively with other activating receptors. Functionally linked to integrin beta-2/ITGB2-mediated neutrophil activation. Also involved in integrin alpha-2/ITGA2-mediated platelet activation. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Protein Families | CD3Z/FCER1G family |
Database References |
Gene Functions References
- FCER1G was identified and validated in association with ccRCC progression and prognosis, which might improve the prognosis by influencing immune-related pathways PMID: 29209141
- mass spectrometry of WT human FcRgamma from receptor-stimulated cells shows consistent preferential phosphorylation of the serine residue at position 51. PMID: 27630214
- FcgammaR-mediated Syk activation leads to NLRP3 inflammasome-dependent IL-1beta production in macrophages and suggests that an Nlrp3- and IL-1R-dependent process contributes to the IgA response important for protection against Francisella tularensis LVS. PMID: 27365531
- Data indicate that the decreasing trend in the expression level of TCRzeta chain, ZAP-70 kinase and epsilon Fc Receptors FcvarepsilonRIgamma was significantly associated with disease progression. PMID: 25513989
- Studies indicate that in response to stimulation with antigen, PHB1 translocated to plasma membrane lipid rafts to form a ternary complex with the high-affinity IgE receptor FcepsilonRIgamma and the nonreceptor tyrosine kinase Syk. PMID: 24023253
- High expression of FCER1G is associated with chronic myeloid leukemia. PMID: 23228155
- There was loss of the negative correlation in the expression levels of CD3eta and FcepsilonRIgamma genes in CLL patients. PMID: 22664044
- CD2-associated adaptor protein (CD2AP) positively regulates blood dendritic cell antigen 2 (BDCA2)/FcepsilonR1gamma signaling by forming a complex with SH2 domain-containing inositol 5'-phosphatase (SHIP)1 to inhibit the E3 ubiquitin ligase Cbl. PMID: 22706086
- Altered expression of the TCR signaling related genes CD3 and FcepsilonRIgamma in patients with aplastic anemia. PMID: 22401598
- Conservation of FcepsilonRI gamma chain coding region in normals and in SLE patients. PMID: 11898918
- FCGR3B quantification confirms the idea of the HNA-1c antigen to be inherited not only linked to HNA-1a, but also to be passed down on its own. PMID: 12366784
- Overexpression of the Fc epsilon RI gamma chain in normal T cells associates with TCR/CD3 complex, contributes to altered T cell signaling, and down-regulates the endogenous TCR zeta-chain expression in human T cells. PMID: 12626537
- evidence that FcepsilonRI-gamma (gamma) associates with 2DL4 to promote surface expression and provide signal transducing function. PMID: 15778339
- Data suggest that by associating with Fc epsilon RI gamma, BDCA2 activates a novel BCR-like signaling pathway to regulate the immune functions of plasmacytoid dendritic cells. PMID: 17850179
- The activating functions of KIR2DL4 killer receptor in natural killer (NK) cells are compartmentalized into distinct structural modules through transmembrane association with the Fc epsilon RI-gamma (FCERIG) receptor. PMID: 18292514
- Elf-1 in combination with Sp1 and GABP reduced FcRgamma promoter activity. PMID: 18378679
- reduced expression in histamin non-releaser basophils PMID: 19362683