Recombinant Human High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha (FCER1A) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10893P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha (FCER1A) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10893P
Collections: Fc receptors, Featured fc receptors molecules, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha (FCER1A) Protein (His) is produced by our Yeast expression system. This is a extracellular protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P12319 |
Target Symbol | FCER1A |
Synonyms | Fc epsilon RI alpha; Fc epsilon RI alpha chain ; Fc epsilon RI alpha-chain; Fc fragment of IgE high affinity I receptor for alpha polypeptide; Fc fragment of IgE; high affinity I; receptor for; alpha subunit; Fc fragment of IgE; high affinity I; receptor for; alpha polypeptide; Fc IgE receptor alpha polypeptide; Fc IgE receptor; alpha chain; Fc IgE receptor; alpha polypeptide; Fc of IgE high affinity I receptor for alpha polypeptide; Fc-epsilon RI-alpha; FCE 1A; FCE1A; FCER 1A; Fcer1a; FCERA_HUMAN; FceRI alpha; FcERI; high affinity IgE receptor; High affinity immunoglobulin epsilon receptor alpha subunit; high affinity immunoglobulin epsilon receptor alpha-subunit; High affinity immunoglobulin epsilon receptor subunit alpha; IgE Fc receptor alpha subunit; IgE Fc receptor subunit alpha; Immunoglobulin E receptor high affinity of mast cells alpha polypeptide ; immunoglobulin E receptor; high-affinity; of mast cells; alpha polypeptide |
Species | Homo sapiens (Human) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ |
Expression Range | 26-205aa |
Protein Length | Extracellular Domain |
Mol. Weight | 23.0kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Database References |
Gene Functions References
- Patient stratification revealed a significant association (P < 0.05) of rs2427827 SNP with high IgE level Chronic Rhinosinusitis with Nasal Polyposis (CRSwNP) patients. Nonetheless, we found no SNP associated with low serum IgE level patients. SNP (rs2427827) in the FcvarepsilonR1alpha gene region and high IgE levels may confer susceptibility to CRSwNP in north Indian population. PMID: 29243845
- Data show that each IgE Fc is targeted by two single-domain antibodies (sdabs) having an epitope largely distinct from the FcepsilonRI binding site but overlapping significantly with the CD23-binding site. PMID: 29295972
- Autoreactive CD4(+) T cells that target FcepsilonRIalpha were detected in most subjects with chronic spontaneous urticaria, with a cytokine secretion profile more typical of a TH1-cell response. Our findings suggest that measurement of T-cell as well as autoantibody responses to FcepsilonRIalpha could improve diagnostic accuracy in subjects with chronic spontaneous urticaria . PMID: 27417022
- Our results suggest that IL13 rs20541, IL4 rs2243250, ADRB2 rs1042713, and FCER1B rs569108, four SNPs with significant sole effect on asthma, interact to confer a higher risk for the disease in Chinese Han children. PMID: 26613553
- F-AFE containing anti-allergic phytochemicals, including arctigenin, inhibited the activation of the FceRI receptor induced by the antigenIgE complex PMID: 26707911
- IgG2 and IgG3 are involved in recruiting CD32 to inhibit activation of FcepsilonRI in human basophils. PMID: 26774660
- Asthmatics with reduced lung function had a higher frequency of Lin(-) CD34(hi) CD117(int/hi) Fc epsilon RI(+) blood mast cell progenitors than asthmatics with normal lung function. PMID: 26626992
- SNPs of FcepsilonR1alpha promoter region may be used as disease markers for IgE-mediated allergic inflammation caused by Dermatophagoides pteronyssinus. PMID: 25923080
- FcepsilonRI alpha-chain is an activating platelet endothelium aggregation receptor 1 (PEAR1) ligand. PMID: 25713122
- Tetraspanin CD151 Is a Negative Regulator of FcepsilonRI-Mediated Mast Cell Activation PMID: 26136426
- These data suggest that rs2298805 might be associated with risk for Chronic urticaria and the therapeutic efficacy of nonsedating H1-antihistamines in Chinese patients PMID: 25412950
- FCER2 polymorphism rs3760687 affects moderately elevated total serum IgE levels, especially in the absence of homozygosity for the risk allele of FCER1A SNP rs2427837. PMID: 24354852
- Data indicate that antigen (Ag) targeting to FcepsilonRI inhibits the development of Ag-specific T cell immunity and induces T cell tolerance. PMID: 24610015
- FCER1A expressing dendritic cells and monocytes but not basophils, significantly contribute to serum hIgE clearance. PMID: 24569373
- elevated levels of surface-bound proteins on cord blood basophils is associated with maternal allergy PMID: 23980848
- Genetic polymorphism is associated with IgE levels in asthmatics in Germany PMID: 23725541
- Overexpression of miR-142-3p enhances FcepsilonRI-mediated degranulation. PMID: 24361879
- We assayed the genotype and allele frequencies of rs2298804 (251 A>G) in the FCER1A gene, in patients with Systemic Lupus Erythematosus in a Chinese Han population and found a significant difference for both the AG genotype and the G allele PMID: 23621092
- no association between SNP in the FCER1A gene region and serum total IgE level in Chinese allergic rhinitis patients PMID: 22800345
- Expression of high-affinity IgE receptor on human peripheral blood dendritic cells in children PMID: 22384272
- Mutation in IgE receptor is associated with mast-cell leukemia. PMID: 22173243
- Linkage disequilibrium and the distribution of haplotypes for two identified human FCER1A 3'-UTR polymorphisms and several previously reported 5'-flanking region and 5'-UTR variants in Japanese and Poles, is described. PMID: 21725845
- genetic polymorphisms in the promoter region is associated with atopic dermatitis in a Han Chinese population PMID: 22222815
- increased FcepsilonRI expression on alveolar mast cells is a novel disease-specific feature of allergic asthma. PMID: 21958156
- Data show that the developed method allows for comparative analysis of sFcepsilonRI levels in health and disease. PMID: 21903095
- There were no significant relationships between FcepsilonRI and atopic dermatitis, although there were trends towards an association between the 66T>C (rs2251746) polymorphism and total serum IgE levels. PMID: 21738338
- FcepsilonRI transgene on dendritic cells drives the cascade of pathogenic reactions linking the initial allergen capture by IgE with subsequent T helper (Th)2-dominated T cell responses and the development of late-phase allergic tissue inflammation. PMID: 21622859
- The crystal structure of IgE bound to FcepsilonRI is determined. PMID: 21516097
- SNPs in the FCER1A gene region show no association with allergic rhinitis in a Han Chinese population PMID: 21209833
- Data indicate that although results rather show the lack of an association between FCER1A rs41264475 mutation and atopic dermatitis, they suggest that its minor allele can predispose to the concomitant asthma in AD patients. PMID: 21216468
- The ability of four synthetic and sequence-specific RNA interfering antisense oligodeoxynucleotides (AS-ODNs) to reduce the expression of FcepsilonRIalpha gene in granulocytes of allergy sufferers in vitro, was investigated. PMID: 19697153
- Secretagogue stimulation results in an increase in the immature p46 form of FcepsilonRIalpha due to reversal of degradative pathways rather than increased synthesis of FcepsilonRIalpha. PMID: 20664273
- FCER1A variants by themselves and in combination influence IgE levels and act synergistically to influence eczema risk. PMID: 20028371
- Data suggest a contribution of Fc epsilonRI alpha and gamma chains either to immunosurveillance or pathophysiology of the intestinal epithelium. PMID: 20126404
- FcRIalpha gene variants are involved in the pathogenesis of IBD. PMID: 20163202
- Data show that atopic dermatitis patients with the FCER1A -315CT/TT genotype tended to have higher total serum IgE levels. PMID: 20141544
- Glucose can augment Fc epsilon RI-mediated mast cell activation, particularly the degranulation response and LTC(4) secretion after prolonged culture of mast cells with high-glucose medium. PMID: 20523060
- counterregulation of FcepsilonRI and TLR-7 pathways exists in Plasmacytoid dendritic cells PMID: 20410486
- genetic polymorphismn, mutational screening and asthma association studies; review PMID: 18726713
- SP downregulated expression of FcepsilonRI in a concentration dependent manner; the effect was mediated by the neurokinin-1 receptor and resulted in reduced mast cell activation. PMID: 20117843
- Expression of FcepsilonRI was significantly elevated on respiratory tract dendritic cells (RTDC) from atopic as compared to nonatopic patients. PMID: 19385959
- homozygosity for the C allele of FcepsilonRI alpha chain variant is associated with lower IgE levels PMID: 12070183
- Regulation of FcepsilonRI-mediated degranulation by an adaptor protein 3BP2 in rat basophilic leukemia RBL-2H3 cells. PMID: 12200378
- Transcriptional regulation of the high affinity IgE receptor alpha-chain gene. PMID: 12217383
- Efficient folding of the FcepsilonRI alpha-chain membrane-proximal domain D2 depends on the presence of the N-terminal domain D1. PMID: 12270716
- mast cells modulate the immune system following TLR4-mediated activation and FcepsilonRI aggregation PMID: 12855579
- In clinically uninvolved skin, Langerhans' cell-surface Fc epsilon RI expression is not only linked to atopic dermatitis but is also generally associated with allergic disease. PMID: 12897750
- T/C polymorphism in Fc epsilon RI alpha-chain promoter at nucleotide position -66 is associated with allergic diseases in a Japanese population. PMID: 12902495
- Fc epsilon RI-mediated calcium flux (dependent on PLC gamma 1) leads to degranulation of mast cells independent of PI 3-kinase PMID: 13129935
- Results indicate that interleukin-4, together with recombinant human stem cell factor, can induce T cell maturation from cord blood progenitor cells, and that IL-4 increased the expression of FcepsilonRI on fetal liver mast cells. PMID: 14746805