Recombinant Human Fibroblast Growth Factor 22 (FGF22) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-06814P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Fibroblast Growth Factor 22 (FGF22) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-06814P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Fibroblast Growth Factor 22 (FGF22) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9HCT0 |
Target Symbol | FGF22 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | TPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS |
Expression Range | 23-170aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 30.1 kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in vitro). May be involved in hair development. |
Subcellular Location | Secreted. |
Protein Families | Heparin-binding growth factors family |
Database References |
Gene Functions References
- This study showed that serum FGF22 levels in depressive patients were negatively correlated with serum IL-1beta levels. In animal and cell experiments, enhancing the levels of FGF22 in rat hippocampus was demonstrated to alleviate the chronic unpredictable mild stress-induced depression. The increase in FGF22 was found to be associated with reduced IL-1beta expression and hippocampal apoptosis. PMID: 28948716