Recombinant Cynomolgus Monkey Igg Receptor Fcrn Large Subunit P51 (FCGRT) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08575P
Greater than 90% as determined by SDS-PAGE.
Recombinant Cynomolgus Monkey Igg Receptor Fcrn Large Subunit P51 (FCGRT) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08575P
Collections: Fc receptors, Featured fc receptors molecules, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Cynomolgus Monkey Igg Receptor Fcrn Large Subunit P51 (FCGRT) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q8SPV9 |
Target Symbol | FCGRT |
Synonyms | FCGRT; FCRNIgG receptor FcRn large subunit p51; FcRn; IgG Fc fragment receptor transporter alpha chain; Neonatal Fc receptor |
Species | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELETPAKSS |
Expression Range | 24-297aa |
Protein Length | Extracellular Domain |
Mol. Weight | 46.4kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cell surface receptor that transfers passive humoral immunity from the mother to the newborn. Binds to the Fc region of monomeric immunoglobulin gamma and mediates its selective uptake from milk. IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids. Throughout life, contributes to effective humoral immunity by recycling IgG and extending its half-life in the circulation. Mechanistically, monomeric IgG binding to FcRn in acidic endosomes of endothelial and hematopoietic cells recycles IgG to the cell surface where it is released into the circulation. In addition of IgG, regulates homeostasis of the other most abundant circulating protein albumin/ALB. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. Endosome membrane. |
Protein Families | Immunoglobulin superfamily |
Database References | KEGG: mcf:102128913 UniGene: Mfa.8387 |
Gene Functions References
- None of the non-synonymous variants of FCGRT or B2M found changes in the amino acid residues known to be important for FcRn function, suggesting that substantial inter-animal variability of FcRn is not expected for the cynomolgus macaques analyzed PMID: 24806819
- Characterization and screening of IgG binding to the neonatal Fc receptor. PMID: 24802048