Recombinant Chicken Fibroblast Growth Factor 2 (FGF2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00393P
Greater than 90% as determined by SDS-PAGE.
Recombinant Chicken Fibroblast Growth Factor 2 (FGF2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00393P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Chicken Fibroblast Growth Factor 2 (FGF2) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P48800 |
Target Symbol | FGF2 |
Species | Gallus gallus (Chicken) |
Expression System | E.coli |
Tag | C-6His |
Target Protein Sequence | PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS |
Expression Range | 13-158aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 23.2 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. |
Subcellular Location | Secreted. Nucleus. |
Protein Families | Heparin-binding growth factors family |
Database References | KEGG: gga:396413 UniGene: Gga.39646 |
Gene Functions References
- synthesis increased in embryonic ventricular cardiomyocytes in response to increased stretch due to pressure overload PMID: 27070743
- Collectively, these studies show that FGF signaling up-regulates expression of alphaA-crystallin both directly and indirectly via up-regulation of c-Maf. PMID: 26719333
- Application of nanoparticles significantly downregulated gene and protein expression of the proangiogenic basic fibroblast growth factor, indicating that both diamond and graphite nanoparticles inhibit angiogenesis. PMID: 24039425
- We propose that this complex behaviour can be due to a perturbation in PIP(2) levels at the plasmamembrane. PMID: 22732451
- BFGF promotes cell survival via the PI3-K pathway and neurite outgrowth via PI3-K, MAPK, and phospholipase Cgamma pathways. PMID: 19405103
- FGF-2 is sufficient to induce dermal condensations, structures that normally form under the control of signals from the epidermal placode PMID: 15532057
- Role of FGF2 in cavitation was shown. PMID: 16425226
- bFGF can promote global growth of the neuritic network both in whole ganglia and in dissociated cultures for times up to 48 hr, and this effect is related to an increase in the growth rate of single neurites. PMID: 16786578
- in chick embryos, the behavior of brain neuroepithelial stem cells at the earliest stages of development is influenced by the action of the FGF2 contained within the E-CSF which could have an extraneural origin PMID: 16916506
- expression of the bFGF gene and protein is low and decreases in the healing tendon PMID: 19084187
- in a three-dimensional retinal tissue context, FGF-2 restricts the pool of photoreceptor cells in favour of cells of the inner retina, increases and maintains their precursor pool, delays their differentiation, and also protects them from apoptosis. PMID: 19453639