Biotinylated Recombinant Human Parechovirus 2 Genome Polyprotein Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-00479P
Greater than 85% as determined by SDS-PAGE.
Biotinylated Recombinant Human Parechovirus 2 Genome Polyprotein Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-00479P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Biotinylated Recombinant Human Parechovirus 2 Genome Polyprotein Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q9YID8 |
Target Symbol | Q9YID8 |
Species | Human parechovirus 5 (strain CT86-6760) (HPeV-5) (Echovirus 23) |
Expression System | E.coli |
Tag | N-MBP&C-6His-Avi |
Target Protein Sequence | METIKSIADMATGFTNTIDSTVNAVTEGVSKIGNDSGGEILTKVADDASNLLGPNCVASTSQPENKDVVQATTTVNTLTNLTQHPSAPTMPFTPDFSNVDVFHSMAYDITTGDKNPSKLIRLDTTTWQHTWPRQHLINDVELPKAFWDKNSKPAYGQSRYFAAVRCGFHFQVQINVNQGTAGCALVVYEPKPIVTHGGHLEFGSYTNLPHVLMNLAETTQADLCIPYVSDTNYVKTDSSDLGRLRVYVWTPLTIPSSATNDVDVTVLGSLLQLDFQNPRTYDTDVNIYDN |
Expression Range | 1-290aa |
Protein Length | Partial |
Mol. Weight | 79.6 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Is not a protease.; Affects membrane integrity and cause an increase in membrane permeability.; Associates with and induces structural rearrangements of intracellular membranes. It displays RNA-binding, nucleotide binding and NTPase activities.; Protein 3A, via its hydrophobic domain, serves as membrane anchor.; cysteine protease that generates mature viral proteins from the precursor polyprotein. In addition to its proteolytic activity, it binds to viral RNA, and thus influences viral genome replication. RNA and substrate bind cooperatively to the protease.; RNA-directed RNA polymerase 3D-POL replicates genomic and antigenomic RNA by recognizing replications specific signals. |
Subcellular Location | [Capsid protein VP3]: Virion. Host cytoplasm.; [Capsid protein VP1]: Virion. Host cytoplasm.; [Protein 2B]: Host cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side.; [Protein 2C]: Host cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side.; [Protein 3A]: Host cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side.; [Protein 3B]: Virion.; [Protease 3C]: Host cytoplasm.; [RNA-directed RNA polymerase 3D-POL]: Host cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. |
Protein Families | Picornaviruses polyprotein family |