Biotinylated Recombinant Human Adenovirus F Serotype 41 Hexon Protein (L3) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-06585P
Greater than 85% as determined by SDS-PAGE.
Biotinylated Recombinant Human Adenovirus F Serotype 41 Hexon Protein (L3) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-06585P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Biotinylated Recombinant Human Adenovirus F Serotype 41 Hexon Protein (L3) Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P11820 |
Target Symbol | L3 |
Species | Human adenovirus F serotype 41 (HAdV-41) (Human adenovirus 41) |
Expression System | E.coli |
Tag | N-MBP&C-6His-Avi |
Target Protein Sequence | NDTNDQSFNDYLCAANMLYPIPSNATSVPISIPSRNWAAFRGWSFTRLKTKETPSLGSGFDPYFTYSGSVPYLDGTFYLNHTFKKVSIMFDSSVSWPGNDRLLTPNEFEIKRTVDGEGYNVAQCNMTKDWFLIQMLSHYNIGYQGFYVPESYKDRMYSFFRNFQPMSRQVVNTTTYKEYQNVTLPFQHNNSGFVGYMGPTMREGQAYPANYPYPLIGQTAVPSLTQKKFLCDRTMWRIPFSSNFMSMGALTDLGQNMLYANSAHALDMTFEVDPMDEPTLLYVLFEVFDVVRIHQPHRGVIEAVYLRTPFSAGNATT |
Expression Range | 609-925aa |
Protein Length | Partial |
Mol. Weight | 84.1 kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Major capsid protein that self-associates to form 240 hexon trimers, each in the shape of a hexagon, building most of the pseudo T=25 capsid. Assembled into trimeric units with the help of the chaperone shutoff protein. Transported by pre-protein VI to the nucleus where it associates with other structural proteins to form an empty capsid. Might be involved, through its interaction with host dyneins, in the intracellular microtubule-dependent transport of incoming viral capsid to the nucleus. |
Subcellular Location | Virion. Host nucleus. |
Protein Families | Adenoviridae hexon protein family |