Biotinylated Recombinant Enterobacteria Phage T4 Recombination Protein Uvsy (UVSY) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-01948P
Greater than 85% as determined by SDS-PAGE.
Biotinylated Recombinant Enterobacteria Phage T4 Recombination Protein Uvsy (UVSY) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-01948P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Biotinylated Recombinant Enterobacteria Phage T4 Recombination Protein Uvsy (UVSY) Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P04537 |
Target Symbol | UVSY |
Species | Enterobacteria phage T4 (Bacteriophage T4) |
Expression System | E.coli |
Tag | N-MBP&C-6His-Avi |
Target Protein Sequence | MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK |
Expression Range | 1-137aa |
Protein Length | Full Length |
Mol. Weight | 63.6kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Plays a role in viral DNA synthesis by promoting enzymatic activities of UvsX recombinase, by promoting UvsX-ssDNA filament assembly, and by helping UvsX to displace bound gp32 from ssDNA. |
Database References | KEGG: vg:1258547 |
Gene Functions References
- UvsY globally stabilizes UvsX-ssDNA complexes, consistent with an increase in the apparent equilibrium binding affinity, K(ss)omega, of the UvsX-ssDNA interactions. PMID: 16634631
- results support a mechanism in which the formation of competent presynaptic filaments requires a hand-off of ssDNA from UvsY to UvsX, with the efficiency of the hand-off controlled by the relative ssDNA-binding affinities of the two proteins. PMID: 19244311