Recombinant Zebrafish IL10 Protein
Beta LifeScience
SKU/CAT #: BLA-1076P
Recombinant Zebrafish IL10 Protein
Beta LifeScience
SKU/CAT #: BLA-1076P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Zebrafish |
Accession | Q5EFQ8 |
Synonym | CSIF Cytokine synthesis inhibitory factor GVHDS IL 10 IL-10 IL10 IL10_HUMAN IL10A Interleukin 10 Interleukin-10 MGC126450 MGC126451 T-cell growth inhibitory factor TGIF |
Description | Recombinant Zebrafish IL10 Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | SRRVECKTDCCSFVEGFPLRLRELRSAYKEIQKFYESNDDLEPLLNEDIK HNINSPYGCHVMNEILHFYLETILPTALQKNPLKHSTTPIDSIGNIFQEL KRDMVKCKRYFSCQNPFEVNSLKNSYEKMKEKGVYKAMGELDLLFRYIEQ YLASKRVKH |
Molecular Weight | 19 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. |