Recombinant Yersinia pestis F1 antigen Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10533P
Recombinant Yersinia pestis F1 antigen Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10533P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Yersinia pestis |
Accession | P26948 |
Synonym | Caf1 F1 capsule antigen |
Description | Recombinant Yersinia pestis F1 antigen Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGG YKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISP KVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ |
Molecular Weight | 18 kDa |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Subcellular Location | Secreted, capsule. |
Database References | KEGG: ype:YPMT1.84 STRING: 187410.Y1100 |