Recombinant vacA Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10477P
Recombinant vacA Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10477P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Helicobacter pylori |
Accession | P55981 |
Synonym | vacA HP_0887 Vacuolating cytotoxin Vacuolating cytotoxin autotransporter Vacuolating cytotoxin translocator |
Description | Recombinant vacA Protein (His tag) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQA GKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDM KDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTT RVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEI SLYDGATLN |
Molecular Weight | 27 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Induces vacuolation of eukaryotic cells. Causes ulceration and gastric lesions. |
Subcellular Location | [Vacuolating cytotoxin autotransporter]: Periplasm.; [Vacuolating cytotoxin]: Secreted. Cell surface.; [Vacuolating cytotoxin translocator]: Cell outer membrane; Multi-pass membrane protein. |
Database References | KEGG: hpy:HP0887 STRING: 85962.HP0887 |
Gene Functions References
- Helicobacter pylori VacA induces autophagic cell death in gastric epithelial cells via the endoplasmic reticulum stress pathway. PMID: 29238039
- The results indicate that cortactin is involved in the regulation of apoptosis induced by VacA in gastric cells. PMID: 26289258
- Genotype testing of vacA s- and m- region will be useful in screening susceptible individuals for duodenal ulcer development. PMID: 25063579
- These results suggested that cagA and vacA gene expression is upregulated in Helicobacter pylori, especially by host cell contact, and Fur has a role in the upregulation. PMID: 24020886