Recombinant Turkey IL1 beta Protein
Beta LifeScience
SKU/CAT #: BLA-1072P
Recombinant Turkey IL1 beta Protein
Beta LifeScience
SKU/CAT #: BLA-1072P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Turkey |
Accession | A3DTN5 |
Synonym | Catabolin H1 IFN beta inducing factor IL 1 IL 1 beta IL-1 beta IL1 IL1 BETA IL1B IL1B_HUMAN IL1F2 Interleukin 1 beta Interleukin 1 beta precursor interleukin 1, beta Interleukin-1 beta OAF Osteoclast activating factor OTTHUMP00000162031 Preinterleukin 1 beta Preinterleukin beta Pro interleukin 1 beta |
Description | Recombinant Turkey IL1 beta Protein was expressed in Yeast. It is a Protein fragment |
Source | Yeast |
AA Sequence | APAFRYTRSQSFDIFDINQKCFVLESPTQLVALHLQGPSSSQKVRLNIAL YRPRGPRGSAGAGQTPVALGIKGYKLYMSCVLSGAEPTLQLEEADVTRDI DSAELTRFVFYRLDSPAEGTTRFESAAFPGWFICTSLQPRQPVGITNRPD QVNIATYKLSGR |
Molecular Weight | 18 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. |