Recombinant Staphylococcus aureus PDF Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10458P
Recombinant Staphylococcus aureus PDF Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10458P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Staphylococcus aureus |
Accession | P68826 |
Synonym | CG6496 DEFM_HUMAN mitochondrial Pdf PDF1A Peptide deformylase Peptide deformylase like protein Peptide deformylase, mitochondrial Polypeptide deformylase |
Description | Recombinant Staphylococcus aureus PDF Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIA KRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSV QEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAI VFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV |
Molecular Weight | 37 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions. |
Protein Families | Polypeptide deformylase family |