Recombinant Staphylococcus aureus HlgC Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10456P
Recombinant Staphylococcus aureus HlgC Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10456P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Staphylococcus aureus |
Accession | Q7A3S2 |
Synonym | Gamma-hemolysin component C hlgC SA2208 |
Description | Recombinant Staphylococcus aureus HlgC Protein (His tag) was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | ANDTEDIGKGSDIEIIKRTEDKTSNKWGVTQNIQFDFVKDKKYNKDALIL KMQGFISSRTTYYNYKKTNHVKAMRWPFQYNIGLKTNDKYVSLINYLPKN KIESTNVSQTLGYNIGGNFQSAPSLGGNGSFNYSKSISYTQQNYVSEVEQ QNSKSVLWGVKANSFATESGQKSAFDSDLFVGYKPHSKDPRDYFVPDSEL PPLVQSGFNPSFIATVSHEKGSSDTSEFEITYGRNMDVTHAIKRSTHYGN SYLDGHRVHNAFVNRNYTVKYEVNWKTHEIKVKGQN |
Molecular Weight | 35 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity. |
Protein Families | Aerolysin family |
Database References | KEGG: sau:SA2208 |