USA  Tel: 1-201-888-7983
Email: info@betalifesci.com

Recombinant Spike Glycoprotein (His tag)

Cat No.: BLA-11477P
Description Related products
accession P15777
description Recombinant Spike Glycoprotein (His tag) was expressed in E.coli. It is a Protein fragment
source E.coli
AA sequence PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCN NIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTAT SCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVY AQHCFKAPSNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCH NAAQCNCLCTPDPIT
molecular weight 27 kDa including tags
purity >85% SDS-PAGE.
endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
formulation Liquid Solution
stability The recombinant protein samples are stable for up to 12 months at -80℃
reconstitution See related COA
unit definition For Research Use Only
storage buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Online Inquiry
For quote, please fill in the online form or send email to info@betalifesci.com.
$50 Coupon