Recombinant Sheep IL2 Protein
Beta LifeScience
SKU/CAT #: BLA-1064P
Recombinant Sheep IL2 Protein
Beta LifeScience
SKU/CAT #: BLA-1064P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Sheep |
Accession | P19114 |
Synonym | Aldesleukin IL 2 IL-2 IL2 IL2_HUMAN Interleukin 2 Interleukin-2 interleukin2 Involved in regulation of T cell clonal expansion Lymphokine OTTHUMP00000164090 POIL2 T Cell Growth Factor T-cell growth factor TCGF |
Description | Recombinant Sheep IL2 Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | APTSSSTGNTMKEVKSLLLDLQLLLEKVKNPENLKLSRMHTFNFYMPKVN ATELKHLKCLLEELKLLEEVLDLAPSKNLNTREIKDSMDNIKRIVLELQG SETRFTCEYDDATVKAVEFLNKWITFCQSIYSTMT |
Molecular Weight | 16 kDa |
Purity | >95% SDS-PAGE.Purified by ion-exchange chromatography. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. |