Recombinant S. pombe Glucan endo-1,3-alpha-glucosidase agn1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10417P
Recombinant S. pombe Glucan endo-1,3-alpha-glucosidase agn1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10417P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Schizosaccharomyces pombe |
Accession | O13716 |
Description | Recombinant S. pombe Glucan endo-1,3-alpha-glucosidase agn1 Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | DKMVVAHFIVGNTYPYTVSNWEEDIQDAIAVGIDGFALNMGSDAWQVERI EDAYDAAASVSSDFKLFISFDMSIISADADFIEGVVRRFADKPNQLYYDG KVFVSTFAGETDTFGYSDVSTGWDSAVKEPLASAGYPIYFVPSWTSLGQG ALEESVADGFLSWNAWPTTDADMNDNDDIGYQNLANSLGKLYVAPVSPWF YTHLSYKNWAYKSDWLIIDRWNEMLSVQPDMIEVLTWNDYGESHYIGNIQ GALPAGSEGYVDGFDHTAWRYLMSPYISAYKLGLSEPYINFESLFYWYRP TPKSATATADSLSYPSGGDYMEDEIFVLVYLLQSAEVTVTCGSTTQTFSG VPGVNQFTIPMETNASPSFTVARQGGTLASGTGPEIVDSLSIYNFNAYTG VLYF |
Molecular Weight | 52 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Has a role in cell separation where it is required for the degradation of the cell wall material surrounding the septum (the septum edging) which must be hydrolyzed before full separation of the daughter cells can occur. Hydrolyzes 1,3-alpha-glucan predominantly into pentasaccharides. |
Subcellular Location | Secreted. Secreted, cell wall. Note=Associates with the cell wall. |
Protein Families | Glycosyl hydrolase 71 family |
Database References | STRING: 4896.SPAC14C4.09.1 |