Recombinant S. cerevisiae Nicotinamidase Protein
Beta LifeScience
SKU/CAT #: BLA-10410P
Recombinant S. cerevisiae Nicotinamidase Protein
Beta LifeScience
SKU/CAT #: BLA-10410P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Saccharomyces cerevisiae |
Accession | P53184 |
Description | Recombinant S. cerevisiae Nicotinamidase Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTR DWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTW GSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLE KHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVIN KVKEELKAHNINVVDK |
Molecular Weight | 25 kDa |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Catalyzes the deamidation of nicotinamide, an early step in the NAD(+) salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate. |
Subcellular Location | Cytoplasm. Nucleus. Peroxisome. |
Protein Families | Isochorismatase family |
Database References | KEGG: sce:YGL037C STRING: 4932.YGL037C |
Gene Functions References
- Enhanced resistance was also independent of the nicotinamide salvage pathway, which uses nicotinamide as a substrate to generate NAD+, and of a DNA damage-induced increase in the salvage enzyme Pnc1 PMID: 27527516
- In this paper, the catalytic mechanism of Pnc1 has been investigated by using a combined quantum-mechanical/molecular-mechanical (QM/MM) approach based on the recently obtained crystal structure of Pnc1. PMID: 24413890
- The overall kinetic mechanism of eukaryotic nicotinamidase from S. cerevisiae (Pnc1) is established through product inhibition analysis, also demonstrating that nicotinamide analogues are Pnc1 inhibitors. PMID: 22229411
- Crystal structure reveals extended helical arrays interwoven to form an unusually robust, yet porous superstructure. PMID: 17382284
- Exogenous nicotinamide can therefore have negative or positive impacts on rDNA silencing, depending on the PNC1 expression level. PMID: 18780747
- overall data showed that PNC1 is a biomarker of mRNA mistranslation and protein misfolding and that PNC1-GFP fusions can be used to monitor these two important biological phenomena in vivo PMID: 19381334