Recombinant rhesus monkey IL1 beta Protein
Beta LifeScience
SKU/CAT #: BLA-1045P
Recombinant rhesus monkey IL1 beta Protein
Beta LifeScience
SKU/CAT #: BLA-1045P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rhesus monkey |
Accession | P48090 |
Synonym | Catabolin H1 IFN beta inducing factor IL 1 IL 1 beta IL-1 beta IL1 IL1 BETA IL1B IL1B_HUMAN IL1F2 Interleukin 1 beta Interleukin 1 beta precursor interleukin 1, beta Interleukin-1 beta OAF Osteoclast activating factor OTTHUMP00000162031 Preinterleukin 1 beta Preinterleukin beta Pro interleukin 1 beta |
Description | Recombinant rhesus monkey IL1 beta Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGE ESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKR FVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTRGGQDITDFTM QFVSS |
Molecular Weight | 17 kDa |
Purity | >98% SDS-PAGE.assessed also by HPLC analysis |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of D10.G4.1 mouse helper T cells is typically 3-10pg/mL. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6. |
Subcellular Location | Cytoplasm, cytosol. Lysosome. Secreted, extracellular exosome. Secreted. |
Protein Families | IL-1 family |
Database References |