Recombinant Rhesus monkey DDR2 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10382P
Recombinant Rhesus monkey DDR2 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10382P
Collections: Enzymes, Kinase, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rhesus monkey |
Accession | G7MEB8 |
Synonym | CD167 antigen-like family member B CD167b CD167b antigen Cell migration inducing protein 20 DDR 2 DDR2 DDR2_HUMAN Discoidin domain containing receptor 2 Discoidin domain receptor 2 Discoidin domain receptor family member 2 discoidin domain receptor tyrosine kinase 2 Discoidin domain-containing receptor 2 discoidin domain-containing receptor tyrosine kinase 2 Hydroxyaryl protein kinase MIG20a Migration inducing gene 16 protein Neurotrophic tyrosine kinase Neurotrophic tyrosine kinase receptor related 3 NTRKR 3 NTRKR3 Receptor protein tyrosine kinase TKT Receptor protein-tyrosine kinase TKT Receptor related 3 receptor-related 3 TKT TYRO 10 TYRO10 Tyrosine kinase receptor related to neurotrophic TRK Tyrosine protein kinase TYRO 10 Tyrosine protein kinase TYRO10 Tyrosine-protein kinase TYRO10 Tyrosylprotein kinase |
Description | Recombinant Rhesus monkey DDR2 Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | KAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGA WCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKIN YSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTD HSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAV GYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEI MFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFP LVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMY NNSGALPTSPMTPTTYDPMLKIDDSNTR |
Molecular Weight | 69 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |