Recombinant Rat IL6 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1021P
Recombinant Rat IL6 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1021P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | P20607 |
Synonym | Interleukin BSF 2 B cell differentiation factor B cell stimulatory factor 2 B-cell stimulatory factor 2 BSF 2 BSF-2 BSF2 CDF CTL differentiation factor Cytotoxic T cell differentiation factor Hepatocyte stimulating factor Hepatocyte stimulatory factor HGF HSF Hybridoma growth factor Hybridoma growth factor Interferon beta-2 Hybridoma plasmacytoma growth factor IFN-beta-2 IFNB2 IL 6 IL-6 IL6 IL6_HUMAN Interferon beta 2 Interferon beta-2 Interleukin 6 Interleukin 6 (interferon beta 2) Interleukin BSF 2 Interleukin-6 |
Description | Recombinant rat IL6 Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Full length protein |
Source | Baculovirus infected insect cells |
AA Sequence | ADPFPTSQVRRGDFTEDTTHNRPVYTTSQVGGLITYVLREILEMRKELCN GNSDCMNSDDALSENNLKLPEIQRNDGCFQTGYNQEICLLKICSGLLEFR FYLEFVKNNLQDNKKDKARVIQSNTETLVHIFKQEIKDSYKIVLPTPTSN ALLMEKLESQKEWLRTKTIQLILKALEEFLKVTMRSTRQTHHHHHH |
Molecular Weight | 23 kDa |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Measured in a cell proliferation assay using M-NFS-60 mouse B cells. The ED50 for this effects is less or equal to 0.1 ng/ml. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |