Recombinant rat Cystatin C Protein
Beta LifeScience
SKU/CAT #: BLA-10294P
Recombinant rat Cystatin C Protein
Beta LifeScience
SKU/CAT #: BLA-10294P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | P14841 |
Synonym | AD 8 AD8 Amyloid angiopathy and cerebral hemorrhage ARMD11 bA218C14.4 bA218C14.4 (cystatin C) Cst 3 Cst3 CST3 protein Cystatin 3 Cystatin-3 Cystatin-C Cystatin3 CystatinC CYTC_HUMAN Epididymis secretory protein Li 2 Gamma trace Gamma-trace HCCAA HEL S 2 MGC117328 Neuroendocrine basic polypeptide Post gamma globulin Post-gamma-globulin |
Description | Recombinant rat Cystatin C Protein was expressed in Baculovirus infected insect cells. It is a Full length protein |
Source | Baculovirus infected insect cells |
AA Sequence | GTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSNDAYHSRAIQVV RARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQ IYSVPWKGTHTLTKSSCKNALEHHHHHH |
Molecular Weight | 14 kDa including tags |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The IC50 value is < 1.0nM. The inhibitory function ofthis protein was measured by a fluorometric assay using Z-FR-AMC at pH 7.5 at 25°C. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |