Recombinant rabbit TIGIT Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-10759P
Recombinant rabbit TIGIT Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-10759P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rabbit |
Accession | G1SLC1 |
Synonym | DKFZp667A205 ENSMUSG00000071552 FLJ39873 RGD1563191 T cell immunoreceptor with Ig and ITIM domains TIGIT TIGIT_HUMAN V-set and immunoglobulin domain containing 9 V-set and immunoglobulin domain-containing protein 9 V-set and transmembrane domain containing 3 V-set and transmembrane domain-containing protein 3 VSIG9 VSTM3 Washington University cell adhesion molecule WUCAM |
Description | Recombinant rabbit TIGIT Protein (Fc Tag Active) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | APLLASGTMASMIVTTGNISAEEGGSAILQCHLSSTTTEVTQVNWEQQDR LLAVRHVDLGWHISPAFKERVVPGPSLSLTLLALTVNDTGEYFCTYHTYP DGIYKGRIFLEVRGSSVAEHSIGFQIP |
Molecular Weight | 40 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized human Nectin-2, His Tag at 5 μg/ml (100 μl/well) can bind this protein with a linear range of 5-78 ng/ml. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. |