Recombinant Rabbit TFPI Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10262P
Recombinant Rabbit TFPI Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10262P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rabbit |
Accession | P19761 |
Synonym | Anti convertin EPI Extrinsic pathway inhibitor LACI Lipoprotein associated coagulation inhibitor Lipoprotein-associated coagulation inhibitor TFI TFPI TFPI 1 TFPI1 TFPI1_HUMAN Tissue factor pathway inhibitor Tissue factor pathway inhibitor (lipoprotein associated coagulation inhibitor) |
Description | Recombinant Rabbit TFPI Protein (His tag) was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQ CEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLE EDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENP TSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQA NEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKG GLIKTKRKKKKQPVKITYVETFVKKT |
Molecular Weight | 35 kDa |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma. |
Subcellular Location | Secreted. |
Database References |
Gene Functions References
- Upregulated TF expression and increased plasma TF level during reperfusion period, reduced plasma TFPI-1 level during reperfusion period. PMID: 20193184