Recombinant Rabbit IL22 Protein
Beta LifeScience
SKU/CAT #: BLA-0974P
Recombinant Rabbit IL22 Protein
Beta LifeScience
SKU/CAT #: BLA-0974P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rabbit |
Accession | G1SFV3 |
Synonym | Cytokine Zcyto18 IL 10 related T cell derived inducible factor IL 21 IL 22 IL D110 IL TIF IL-10-related T-cell-derived-inducible factor IL-22 IL-TIF IL21 Il22 IL22_HUMAN ILD110 ILTIF Interleukin 10 related T cell derived inducible factor interleukin 21 Interleukin 22 Interleukin-22 MGC79382 MGC79384 TIFa TIFIL 23 TIFIL23 UNQ3099/PRO10096 zcyto18 |
Description | Recombinant Rabbit IL22 Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | LPISSHCRLDESNFTSYITNLTFMLAKEANSADNNTDVRLIGNELFHGVN EKDHCYLLKHVLNFTLEEVLFPESDRFQPYMQQVLSFLAKLSNNLSQCHI EGDDQHIQRNVQQLKDTVKQLGESGEIKAIGELDLLFMALRTACVSPEQS WKMS |
Molecular Weight | 18 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. |